27.01.2020
220.017.facc

ЛЕЧЕНИЕ РАКА С ПОМОЩЬЮ ГУМАНИЗИРОВАННОГО АНТИ-CD19 ХИМЕРНОГО АНТИГЕННОГО РЕЦЕПТОРА

Вид РИД

Изобретение

Юридическая информация Свернуть Развернуть
№ охранного документа
0002711975
Дата охранного документа
23.01.2020
Краткое описание РИД Свернуть Развернуть
Аннотация: Настоящее изобретение относится к области иммунологии. Предложены выделенная молекула нуклеиновой кислоты, кодирующая анти-CD19 химерный антигенный рецептор, выделенная молекула анти-CD19 химерный антигенный рецептор, а также гуманизированный анти-CD19-связывающий домен. Кроме того, рассмотрен вектор, клетки, способ получения клетки, способ получения популяции клеток, способ создания противоопухолевого иммунитета и способ лечения. Также описаны выделенные молекулы нуклеиновой кислоты, кодирующие анти-CD19 CAR. Данное изобретение может найти дальнейшее применение в терапии различных пролиферативных заболеваний, ассоциированных с экспрессией CD19, в частности рака. 15 н. и 68 з.п. ф-лы, 12 ил., 6 табл., 6 пр.
Реферат Свернуть Развернуть

По настоящей заявке испрашивается приоритет на основании предварительной патентной заявки США с порядковым номером 61/802629, поданной 16 марта 2013 г., и предварительной патентной заявки США с порядковым номером 61/838537, поданной 24 июня 2013 г., полное содержание каждой из которых включено в настоящий документ посредством ссылки.

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

Настоящая заявка содержит список последовательностей, который представлен в электронном виде в формате ASCII и включен в настоящий документ посредством ссылки в полном объеме. Указанная ASCII-копия, созданная 14 марта 2014 г., называется N2067-7002WO_SL.txt и имеет размер 228415 байт.

ОБЛАСТЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

Настоящее изобретение относится, главным образом, к использованию T-клеток, генетически измененных для экспрессии химерного антигенного рецептора (CAR), для лечения заболевания, ассоциированного с экспрессией белка кластера дифференцировки 19 (CD19).

УРОВЕНЬ ТЕХНИКИ ИЗОБРЕТЕНИЯ

У многих пациентов B-клеточные злокачественные новообразования не поддаются лечению стандартными терапевтическими методами. Кроме того, традиционные методы лечения часто имеют серьезные побочные эффекты. Были предприняты попытки иммунотерапии рака, однако некоторые обстоятельства делают достижение клинической эффективности трудной задачей. Хотя были идентифицированы сотни так называемых опухолевых антигенов, они, как правило, получены из собственных опухолей и, следовательно, имеют слабую иммуногенность. Кроме того, опухоли имеют несколько механизмов противостояния началу и распространению иммунной атаки.

Недавние разработки в области терапии с использованием модифицированных химерным антигенным рецептором (CAR) аутологичных T-клеток (CART), основанной на перенаправлении T-клеток на соответствующие молекулы на поверхности раковых клеток, таких как B-клеточные злокачественные новообразования, показывают многообещающие результаты в использовании потенциала иммунной системы для лечения B-клеточных злокачественных новообразований и других видов рака (смотри, например, Sadelain et al., Cancer 1907393 1 Discovery 3: 388-398 (2013)). Клинические результаты применения мышиных CART19 (то есть, «CTL019») показали многообещающие результаты в достижении полной ремиссии у пациентов, страдающих CLL, а также в случае детского ALL (смотри, например, Kalos et al., Sci Transl Med 3: 95ra73 (2011), Porter et al., NEJM 365: 725-733 (2011), Grupp et al., NEJM 368: 1509-1518 (2013)). Помимо способности генетически модифицированных Т-клеток, имеющих на своей поверхности химерный антигенный рецептор, узнавать и уничтожать целевые клетки, для успешного лечения терапевтическими T-клетками они должны обладать способностью пролиферировать и сохраняться в течение долгого времени, а также в дальнейшем контролировать уцелевшие лейкозные клетки. Разное качество T-клеток, являющееся результатом анергии, подавления или истощения, будет оказывать влияние на эффективность CAR-трансформированных T-клеток, которую в настоящее время квалифицированные специалисты могут контролировать лишь в ограниченной степени. Для того, чтобы быть эффективными, CAR-трансформированные T-клетки пациента должны сохраняться и поддерживать способность пролиферировать в ответ на антиген CAR. Показано, что T-клетки пациента с ALL способны к этому в случае CART19, содержащего scFv мыши (смотри, например, Grupp et al., NEJM 368: 1509-1518 (2013)).

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Изобретение относится к контролированию иммунного ответа у пациентов путем обеспечения оптимизированных и гуманизированных фрагментов антитела (например, scFv), связывающих белок кластера дифференцировки 19 (CD19), интегрированных в конструкцию химерного антигенного рецептора (CAR), которая не будет вызывать иммунный ответ у пациентов, безопасна для использования в течение долгого времени и демонстрирует сходную или превосходящую клиническую эффективность в сравнении с известным терапевтическим средством на основе CART для лечения B-клеточных злокачественных новообразований. Кроме того, изобретение относится к использованию T-клеток, генетически измененных для экспрессии гуманизированного фрагмента антитела, который связывает CD19, интегрированного в CAR, для лечения рака крови, ассоциированного с экспрессией CD19 (регистрационный № OMIM 107265, регистрационный № Swiss Prot. P15391).

Соответственно, в одном аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей химерный антигенный рецептор (CAR), при этом CAR содержит антитело или фрагмент антитела, которые включают гуманизированный анти-CD19 связывающий домен, трансмембранный домен и внутриклеточный сигнальный домен (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен). В одном варианте осуществления CAR содержит антитело или фрагмент антитела, которые включают гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, трансмембранный домен, описанный в настоящем документе, и внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен).

В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и/или одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, кодируемый гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления кодируемая вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления кодируемая вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления кодируемая вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления кодируемая вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3), например, по меньшей мере две гуманизированные вариабельные области тяжелой цепи, описанные в настоящем документе (например, в таблице 3). В одном варианте осуществления кодируемый анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления кодируемый трансмембранный домен представляет собой трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета-цепи T-клеточного рецептора, CD27, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137 и CD154. В одном варианте осуществления кодируемый трансмембранный домен содержит последовательность SEQ ID NO: 15. В одном варианте осуществления кодируемый трансмембранный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 15, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 15. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая трансмембранный домен, содержит последовательность SEQ ID NO: 56 или последовательность, имеющую 95-99% идентичности с ней.

В одном варианте осуществления кодируемый анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной в настоящем документе. В одном варианте осуществления кодируемая шарнирная область содержит SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая шарнирную область, содержит последовательность SEQ ID NO: 55 или SEQ ID NO: 46, или SEQ ID NO: 48, или последовательность, имеющую 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты дополнительно содержит последовательность, кодирующую костимулирующий домен. В одном варианте осуществления костимулирующий домен представляет собой функциональный сигнальный домен, полученный из белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления кодируемый костимулирующий домен содержит последовательность SEQ ID NO: 16. В одном варианте осуществления кодируемый костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая костимулирующий домен, содержит последовательность SEQ ID NO: 60 или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты дополнительно содержит последовательность, кодирующую внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит функциональный сигнальный домен CD27 и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и/или последовательность SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессированы в одной и той же рамке считывания и в виде одной полипептидной цепи. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая внутриклеточный сигнальный домен, содержит последовательность SEQ ID NO: 60 или последовательность, имеющую 95-99% идентичности с ней, и/или последовательность SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая внутриклеточный сигнальный домен, содержит последовательность SEQ ID NO: 52 или последовательность, имеющую 95-99% идентичности с ней, и/или последовательность SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющую 95-99% идентичности ними.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей конструкцию CAR, содержащую лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе, например, SEQ ID NO: 13; гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, содержащий LC CDR1, LC CDR2, LC CDR3, HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, описанный в таблице 3, или последовательность, имеющую 95-99% идентичности с ним; шарнирную область, описанную в настоящем документе, например, SEQ ID NO: 14 или SEQ ID NO: 45; трансмембранный домен, описанный в настоящем документе, например, трансмембранный домен, содержащий SEQ ID NO: 15, и внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления кодируемый внутриклеточный сигнальный домен содержит костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе, например, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16 или SEQ ID NO: 51, и/или основной сигнальный домен, например, основной сигнальный домен, описанный в настоящем документе, например, сигнальный домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит лидерную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 54, или последовательность, имеющую 95-99% идентичности с ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит последовательность гуманизированного анти-CD19 связывающего домена, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит трансмембранную последовательность, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 56, или последовательность, имеющую 95-99% идентичности ней. В одном варианте осуществления выделенная молекула нуклеиновой кислоты, кодирующая конструкцию CAR, содержит последовательность внутриклеточного сигнального домена, кодируемую последовательностью нуклеиновой кислоты SEQ ID NO: 60, или последовательность, имеющую 95-99% идентичности с ней, и/или последовательностью нуклеиновой кислоты SEQ ID NO: 101 или SEQ ID NO: 44, или последовательность, имеющей 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты содержит (например, состоит из) нуклеиновую кислоту, кодирующую аминокислотную последовательность CAR с SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую по меньшей мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более чем 60, 50 или 40 модификаций (например, замен), аминокислотной последовательности, или аминокислотную последовательность, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с аминокислотной последовательностью SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42.

В одном варианте осуществления выделенная молекула нуклеиновой кислоты содержит (например, состоит из) последовательность нуклеиновой кислоты SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 или SEQ ID NO: 96, или последовательность нуклеиновой кислоты, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с последовательностью нуклеиновой кислоты SEQ ID NO: 85, SEQ ID NO: 86, SEQ ID NO: 87, SEQ ID NO: 88, SEQ ID NO: 89, SEQ ID NO: 90, SEQ ID NO: 91, SEQ ID NO: 92, SEQ ID NO: 93, SEQ ID NO: 94, SEQ ID NO: 95 или SEQ ID NO: 96.

В одном аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей гуманизированный анти-CD19 связывающий домен, при этом анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12). В одном варианте осуществления кодируемый гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12. В одном из вариантов осуществления гуманизированный анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 или 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 69, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними.

В другом аспекте изобретение относится к выделенной молекуле полипептида, кодируемой последовательностью нуклеиновой кислоты. В одном варианте осуществления выделенная молекула полипептида содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 и SEQ ID NO: 42. В одном варианте осуществления выделенный полипептид содержит последовательность SEQ ID NO: 31. В одном варианте осуществления выделенный полипептид содержит последовательность SEQ ID NO: 32. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 35. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 36. В одном варианте осуществления выделенная молекула полипептида содержит последовательность SEQ ID NO: 37.

В другом аспекте изобретение относится к выделенной молекуле химерного антигенного рецептора (CAR), содержащего гуманизированный анти-CD19 связывающий домен (например, гуманизированное антитело или фрагмент антитела, которые специфически связываются с CD19), трансмембранный домен и внутриклеточный сигнальный домен (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен). В одном варианте осуществления CAR содержит антитело или фрагмент антитела, содержащие гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе (например, гуманизированное антитело или фрагмент антитела, которые специфически связываются с CD19, как описано в настоящем документе), трансмембранный домен, описанный в настоящем документе, и внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или основной сигнальный домен, описанные в настоящем документе).

В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном варианте осуществления выделенная молекула CAR содержит трансмембранный домен белка, выбранного из группы, состоящей из альфа, бета или дзета цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD 137 и CD 154. В одном варианте осуществления трансмембранный домен содержит последовательность SEQ ID NO: 15. В одном варианте осуществления трансмембранный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 15, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 15.

В одном варианте осуществления гуманизированный анти-CD19 связывающий домен связан с трансмембранным доменом с помощью шарнирной области, например, шарнирной области, описанной в настоящем документе. В одном варианте осуществления закодированная шарнирная область содержит SEQ ID NO: 14 или SEQ ID NO: 45, или последовательность, имеющую 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит последовательность, кодирующую костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе. В одном варианте осуществления костимулирующий домен содержит функциональный сигнальный домен белка, выбранного из группы, состоящей из OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18), ICOS (CD278) и 4-1BB (CD137). В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 16. В одном варианте осуществления костимулирующий домен содержит последовательность SEQ ID NO: 51. В одном варианте осуществления костимулирующий домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит последовательность, кодирующую внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен 4-1BB и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 17. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 и/или последовательность SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит функциональный сигнальный домен CD27 и/или функциональный сигнальный домен CD3-дзета. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 51 и/или последовательность SEQ ID NO: 17. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 51 и/или последовательность SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 20, 10 или 5 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательности SEQ ID NO: 17 или SEQ ID NO: 43, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 16 или SEQ ID NO: 51 и/или аминокислотной последовательностью SEQ ID NO: 17 или SEQ ID NO: 43. В одном варианте осуществления внутриклеточный сигнальный домен содержит последовательность SEQ ID NO: 16 или SEQ ID NO: 51 и последовательность SEQ ID NO: 17 или SEQ ID NO: 43, при этом последовательности, составляющие внутриклеточный сигнальный домен, экспрессируются в одной и той же рамке считывания и в виде одной полипептидной цепи.

В одном варианте осуществления выделенная молекула CAR дополнительно содержит лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе. В одном варианте осуществления лидерная последовательность содержит аминокислотную последовательность SEQ ID NO: 13 или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 13.

В другом аспекте изобретение относится к выделенной молекуле CAR, содержащей лидерную последовательность, например, лидерную последовательность, описанную в настоящем документе, например, лидерную последовательность SEQ ID NO: 13, или имеющую 95-99% идентичности с ней; гуманизированный анти-CD19 связывающий домен, описанный в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, содержащий LC CDR1, LC CDR2, LC CDR3, HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе, например, гуманизированный анти-CD19 связывающий домен, приведенный в таблице 3, или последовательность, имеющую 95-99% идентичности с ним; шарнирную область, например, шарнирную область, описанную в настоящем документе, например, шарнирную область SEQ ID NO: 14 или имеющую 95-99% идентичности с ней; трансмембранный домен, например, трансмембранный домен, описанный в настоящем документе, например, трансмембранный домен, имеющий последовательность SEQ ID NO: 15 или последовательность, имеющую 95-99% идентичности с ней; внутриклеточный сигнальный домен, например, внутриклеточный сигнальный домен, описанный в настоящем документе (например, внутриклеточный сигнальный домен, содержащий костимулирующий домен и/или a основной сигнальный домен). В одном варианте осуществления внутриклеточный сигнальный домен содержит костимулирующий домен, например, костимулирующий домен, описанный в настоящем документе, например, костимулирующий домен 4-1BB, имеющий последовательность SEQ ID NO: 16 или SEQ ID NO: 51, или имеющий 95-99% идентичности с ними, и/или основной сигнальный домен, например, основной сигнальный домен, описанный в настоящем документе, например, сигнальный домен CD3-дзета, имеющий последовательность SEQ ID NO: 17 или SEQ ID NO: 43, или имеющий 95-99% идентичности с ними.

В одном варианте осуществления выделенная молекула CAR содержит (например, состоит из) аминокислотную последовательность SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую по меньшей мере одну, две, три, четыре, пять, 10, 15, 20 или 30 модификаций (например, замен), но не более чем 60, 50 или 40 модификаций (например, замен), аминокислотной последовательности SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42, или аминокислотную последовательность, имеющую 85%, 90%, 95%, 96%, 97%, 98% или 99% идентичности с аминокислотной последовательностью SEQ ID NO: 31, SEQ ID NO: 32, SEQ ID NO: 33, SEQ ID NO: 34, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 37, SEQ ID NO: 38, SEQ ID NO: 39, SEQ ID NO: 40, SEQ ID NO: 41 или SEQ ID NO: 42.

В одном аспекте изобретение относится к гуманизированному анти-CD19 связывающему домену, содержащему одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) анти-CD19 связывающего домена, описанного в настоящем документе, и одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит по меньшей мере HC CDR2. В одном варианте осуществления вариабельная область легкой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VK3_L25. В одном варианте осуществления вариабельная область легкой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области легкой цепи SEQ ID NO: 58 мыши, например, замену в одном или более из положений 71 и 87). В одном варианте осуществления вариабельная область тяжелой цепи содержит одну, две, три или все четыре каркасные области последовательности зародышевой линии VH4_4-59. В одном варианте осуществления вариабельная область тяжелой цепи имеет модификацию (например, замену, например, замену одной или более аминокислот, находящихся в соответствующем положении в вариабельной области тяжелой цепи SEQ ID NO: 58, например, замену в одном или более из положений 71, 73 и 78). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит вариабельную область легкой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12), и/или вариабельную область тяжелой цепи, описанную в настоящем документе (например, в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12. В одном из вариантов осуществления гуманизированный анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12.

В другом аспекте изобретение относится к вектору, содержащему последовательность нуклеиновой кислоты, кодирующую CAR. В одном варианте осуществления вектор выбран из группы, состоящей из ДНК, РНК, плазмиды, лентивирусного вектора, аденовирусного вектора или ретровирусного вектора.

В одном варианте осуществления вектор представляет собой лентивирусный вектор. В одном варианте осуществления вектор дополнительно содержит промотор. В одном варианте осуществления промотор представляет собой промотор EF-1. В одном варианте осуществления промотор EF-1 содержит последовательность SEQ ID NO: 100.

В одном варианте осуществления вектор представляет собой in vitro транскрибируемый вектор, например, вектор, который транскрибирует РНК молекулы нуклеиновой кислоты, описанной в настоящем документе. В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит поли(A)-последовательность, например, поли(A)-последовательность, описанную в настоящем документе, например, содержащую примерно 150 оснований аденозина (SEQ ID NO: 104). В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит 3'UTR, например, 3'UTR, описанную в настоящем документе, например, содержащую по меньшей мере один повтор 3'UTR из бета-глобулина человека. В одном варианте осуществления последовательность нуклеиновой кислоты в векторе дополнительно содержит промотор, например, промотор T2A.

В другом аспекте изобретение относится к клетке, содержащей вектор. В одном варианте осуществления клетка представляет собой человеческую T-клетку. В одном варианте осуществления клетка представляет собой клетку, описанную в настоящем документе, например, человеческую T-клетку, например, человеческую T-клетку, описанную в настоящем документе. В одном варианте осуществления человеческая T-клетка представляет собой CD8+ T-клетку.

В другом варианте осуществления CAR-экспрессирующая клетка, описанная в настоящем документе, может дополнительно экспрессировать другой агент, например, агент, повышающий активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может быть агентом, который ингибирует ингибирующую молекулу. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR-бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TEVI3, 2B4 и TIGIT, или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них), и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 41BB, CD27 или CD28, например, описанные в настоящем документе) и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе).

В другом аспекте изобретение относится к способу получения клетки, включающему трансдуцирование T-клетки вектором, содержащим нуклеиновую кислоту, кодирующую CAR, например, CAR, описанный в настоящем документе.

Настоящее изобретение также относится к способу получения популяции клеток с генетически измененной РНК, например, клеток, описанных в настоящем документе, например, T-клеток, временно экспрессирующих экзогенную РНК. Способ включает введение in vitro транскрибированной РНК или синтетической РНК в клетку, при этом РНК содержит нуклеиновую кислоту, кодирующую молекулу CAR, описанную в настоящем документе.

В другом аспекте изобретение относится к способу создания противоопухолевого иммунитета у млекопитающего, включающему введение млекопитающему эффективного количества клетки, содержащей молекулу CAR, например, клетки, экспрессирующей молекулу CAR, описанную в настоящем документе. В одном варианте осуществления клетка представляет собой аутологичную T-клетку. В одном варианте осуществления клетка представляет собой аллогенную Т-клетку. В одном варианте осуществления млекопитающее является человеком.

В другом аспекте изобретение относится к способу лечения млекопитающего, страдающего заболеванием, ассоциированным с экспрессией CD19, включающему введение млекопитающему эффективного количества клетки, содержащей молекулу CAR, например, молекулу CAR, описанную в настоящем документе.

В одном варианте осуществления заболевание, ассоциированное с экспрессией CD19, выбирают из пролиферативного заболевания, такого как рак или злокачественное новообразование или предраковое состояние, такое как миелодисплазия, миелодиспластический синдром или предлейкоз, или оно представляет собой не относящиеся к раку симптомы, ассоциированные с экспрессией CD19. В одном варианте осуществления заболевание представляет собой рак крови. В одном варианте осуществления рак крови представляет собой лейкоз. В одном варианте осуществления рак выбирают из группы, состоящей из одной или более форм острого лейкоза, включая, но не ограничиваясь ими, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одной или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL); других форм рака крови или патологических состояний крови, включая, но не ограничиваясь ими, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, при которых экспрессируется CD19; а также любые их сочетания.

В одном варианте осуществления инфузию лимфоцитов, например, инфузию аллогенных лимфоцитов, используют в лечении рака, при этом вводимые инфузией лимфоциты содержат по меньшей мере одну CD19 CAR-экспрессирующую клетку. В одном варианте осуществления в лечении рака используют инфузию аутологичных лимфоцитов, при этом вводимые инфузией аутологичные лимфоциты содержат по меньшей мере одну CD19 CAR-экспрессирующую клетку.

В одном варианте осуществления CD19 CAR-экспрессирующую клетку, например, T-клетку, вводят субъекту, которому ранее была проведена трансплантация стволовых клеток, например, трансплантация аутологичных стволовых клеток.

В одном варианте осуществления CD19 CAR-экспрессирующую клетку, например, T-клетку, вводят субъекту, который ранее получал дозу мелфалана.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который повышает эффективность клетки, экспрессирующей молекулу CAR, например, агентом, описанным в настоящем документе.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который ослабляет один или более побочных эффектов, связанных с введением клетки, экспрессирующей молекулу CAR, например, агентом, описанным в настоящем документе.

В одном варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в сочетании с агентом, который лечит заболевание, ассоциированное с CD19, например, агентом, описанным в настоящем документе.

В одном варианте осуществления, клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в дозе и/или в режиме дозирования, описанных в настоящем документе.

В одном варианте осуществления молекулу CAR вводят в T-клетки, например, с использованием in vitro транскрипции, и субъекту (например, человеку) первоначально вводят клетки, содержащие молекулу CAR, с одним или более последующими введениями клеток, содержащих молекулу CAR, при этом одно или более последующих введений выполняют через менее чем 15 дней, например, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 или 2 дней после предыдущего введения. В одном варианте осуществления более одного введения клеток, содержащих молекулу CAR, выполняют для субъекта (например, человека) в неделю, например, в неделю выполняют 2, 3 или 4 введения клеток, содержащих молекулу CAR. В одном варианте осуществления субъект (например, субъект-человек) получает более одного введения клеток, содержащих молекулу CAR, в неделю (например, 2, 3 или 4 введения в неделю) (что в настоящем документе также называют циклом), затем следует неделя без введения клеток, содержащих молекулу CAR, и вслед за этим одно или более дополнительных введений клеток, содержащих молекулу CAR, (например, более одного введения клеток, содержащих молекулу CAR, в неделю) выполняют для субъекта. В другом варианте осуществления субъект (например, субъект-человек) получает более одного цикла введения клеток, содержащих молекулу CAR, и период времени между циклами составляет менее 10, 9, 8, 7, 6, 5, 4 или 3 дней. В одном варианте осуществления клетки, содержащие молекулу CAR, вводят через день, что составляет 3 введения в неделю. В одном варианте осуществления клетки, содержащие молекулу CAR, вводят в течение по меньшей мере двух, трех, четырех, пяти, шести, семи, восьми или более недель.

В одном варианте осуществления, клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в качестве терапии первой линии для заболевания, например, рака, например, рака, описанного в настоящем документе. В другом варианте осуществления клетки, экспрессирующие молекулу CAR, например, молекулу CAR, описанную в настоящем документе, вводят в качестве терапии второй, третьей, четвертой линии лечения для заболевания, например, рака, например, рака, описанного в настоящем документе.

В одном варианте осуществления, вводят популяцию клеток, описанных в настоящем документе.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по изобретению, выделенной молекуле полипептида CAR по изобретению, вектору, содержащему CAR по изобретению, а также клетке, содержащей CAR по изобретению, для использования в качестве лекарственного средства.

В другом аспекте изобретение относится к выделенной молекуле нуклеиновой кислоты, кодирующей CAR по изобретению, выделенной молекуле полипептида CAR по изобретению, вектору, содержащему CAR по изобретению, а также клетке, содержащей CAR по изобретению, для использования в лечении заболевания, при котором экспрессируется CD19.

В одном аспекте изобретение относится к популяции аутологичных клеток, которые трансфицированы или трансдуцированы вектором, содержащим молекулу нуклеиновой кислоты, кодирующую молекулу CD19 CAR, например, описанную в настоящем документе. В одном варианте осуществления вектор представляет собой ретровирусный вектор. В одном варианте осуществления вектор представляет собой самоинактивирующийся лентивирусный вектор, описанный в другом разделе настоящего документа. В одном варианте осуществления вектор доставляют (например, путем трансфекции или электропорации) в клетку, например, T-клетку, при этом вектор содержит молекулу нуклеиновой кислоты, кодирующую молекулу CD19 CAR, описанную в настоящем документе, которая транскрибируется в виде молекулы мРНК, и молекула CD19 CAR транслируется с молекулы РНК и экспрессируется на поверхности клетки.

В другом аспекте настоящее изобретение относится к популяции CAR-экспрессирующих клеток, например, клеток CART. В некоторых вариантах осуществления популяция CAR-экспрессирующих клеток содержит смесь клеток, экспрессирующих различные CAR. Например, в одном варианте осуществления популяция клеток CART может содержать первую клетку, экспрессирующую CAR, имеющий анти-CD19 связывающий домен, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, имеющий другой анти-CD19 связывающий домен, например, анти-CD19 связывающий домен, описанный в настоящем документе, который отличается от анти-CD19 связывающего домена в CAR, экспрессируемом первой клеткой. В качестве другого примера, популяция CAR-экспрессирующих клеток может содержать первую клетку, экспрессирующую CAR, имеющий анти-CD19 связывающий домен, например, описанный в настоящем документе, и вторую клетку, экспрессирующую CAR, имеющий антигенсвязывающий домен для мишени, отличной от CD19 (например, CD123). В одном варианте осуществления популяция CAR-экспрессирующих клеток содержит, например, первую клетку, экспрессирующую CAR, имеющий основной внутриклеточный сигнальный домен, и вторую клетку, экспрессирующую CAR, имеющий вспомогательный сигнальный домен.

В другом аспекте настоящее изобретение относится к популяции клеток, в которой по меньшей мере одна клетка экспрессирует CAR, имеющий анти-CD19 домен, описанный в настоящем документе, и вторая клетка экспрессирует другой агент, например, агент, который повышает активность CAR-экспрессирующей клетки. Например, в одном варианте осуществления агент может представлять собой агент, который ингибирует ингибирующую молекулу. Примеры ингибирующих молекул включают PD1, PD-L1, CTLA4, TIM3, LAG3, VISTA, BTLA, TIGIT, LAIR1, CD160, 2B4 и TGFR-бета. В одном варианте осуществления агент, который ингибирует ингибирующую молекулу, содержит первый полипептид, например, ингибирующую молекулу, связанный со вторым полипептидом, который обеспечивает положительный сигнал для клетки, например, внутриклеточный сигнальный домен, описанный в настоящем документе. В одном варианте осуществления агент содержит первый полипептид, например, ингибирующую молекулу, такую как PD1, LAG3, CTLA4, CD160, BTLA, LAIR1, TEVI3, 2B4 и TIGIT, или фрагмент любой из них (например, по меньшей мере часть внеклеточного домена любой из них) и второй полипептид, который представляет собой внутриклеточный сигнальный домен, описанный в настоящем документе (например, содержащий костимулирующий домен (например, 41BB, CD27 или CD28, например, как описано в настоящем документе) и/или основной сигнальный домен (например, сигнальный домен CD3-дзета, описанный в настоящем документе). В одном варианте осуществления агент содержит первый полипептид молекулы PD1 или ее фрагмент (например, по меньшей мере часть внеклеточного домена PD1) и второй полипептид внутриклеточного сигнального домена, описанного в настоящем документе (например, сигнального домена CD28, описанного в настоящем документе, и/или сигнального домена CD3-дзета, описанного в настоящем документе).

В одном варианте осуществления молекула нуклеиновой кислоты, кодирующая молекулу CD19 CAR, например, описанную настоящем документе, экспрессируется в виде молекулы мРНК. В одном варианте осуществления генетически модифицированные CD19 CAR-экспрессирующие клетки, например, T-клетки, можно получать путем трансфекции или электропорации молекулы РНК, кодирующей нужные CAR (например, без последовательности вектора), в клетку. В одном варианте осуществления молекула CD19 транслируется с молекулы РНК после ее введения и экспрессируется на поверхности рекомбинантной клетки.

КРАТКОЕ ОПИСАНИЕ ЧЕРТЕЖЕЙ

На фигурах 1A, 1B и 1C графически представлены результаты анализа цитотоксичности с использованием T-клеток ND317 (нормальных донорских), трансдуцированных анти-CD19 CAR мыши или гуманизированными анти-CD19 CAR по изобретению и культивируемых либо с контрольными клетками K562, которые не экспрессируют CD19 (K562cc), как показано на фигуре 1A, клетками K562, трансформированными CD19 (K562.CD19), как показано на фигуре 1B, или злокачественными B-клетками, полученными от пациента с CLL (B-клеточный изолят Pt 14), как показано на фигуре 1C.

На фигурах 2A и 2B приведены графики, демонстрирующие пролиферативный ответ клеток, экспрессирующих гуманизированные и мышиные анти-CD19 CAR, на CD19+ клетки, при этом большее число жизнеспособных CAR+ T-клеток коррелирует с популяциями, демонстрирующими максимальную пролиферацию CD4+ и CD8+ T-клеток в ответ на первичные клетки CLL.

На фигуре 3 графически представлены развернутые ВЭЖХ масс-спектры для scFvs по изобретению, при этом верхний ряд соответствует необработанному scFv и нижний ряд соответствует родственному дегликозилированному scFv.

На фигуре 4 графически представлена конформационная стабильность по результатам измерения методом дифференциальной сканирующей флуориметрии. Tm для мышиных scFv составляла 57°C (жирная линия). Для всех гуманизированных вариантов scFv были характерны более высокие значения Tm около 70°C по сравнению с родительскими мышиными scFv. Остатки, введенные в процессе гуманизации, приводили к повышению Tm более чем на 10°C.

На фигуре 5 графически представлена пролиферация трансдуцированных CD19 CAR T-клеток, при этом клетки CART19 были направлены либо против (a) линии клеток хронического миелогенного лейкоза («CML»), которые отрицательны в отношении экспрессии CD19 и, вследствие этого, были использованы в качестве отрицательного контроля; (b) рекомбинантных клеток K562, которые положительны в отношении экспрессии CD19, и, вследствие этого, были использованы в качестве положительного контроля, или (c) B-клеток Pt14, полученных от пациента с CLL, которые экспрессируют CD19 на клеточной поверхности.

На фигурах 6A и 6B схематически изображены репрезентативные CAR.

На фигуре 7 показано прогрессирование первичного ALL заболевания HALLX5447 у мышей NSG после лечения трансдуцированными CD19 CAR T-клетками. Рост клеток первичного ALL человека у мышей NSG после лечения CAR T-клетками, специфичными в отношении CD19, продемонстрировал контроль над прогрессированием заболевания. Средний процент CD19+ ALL клеток человека в периферической крови у мышей NSG служил показателем бремени заболевания ко дню 65 после имплантации опухоли. Черные кружки: мыши получали 100 мкл PBS через хвостовую вену; красные квадраты: мыши получали суррогатные трансдуцированные T-клетки; синие треугольники: мыши получали трансдуцированные мышиным CD19 CAR T-клетки и перевернутые фиолетовые треугольники: мыши получали трансдуцированные гуманизированным CD19 CAR T-клетки. Статистическую значимость рассчитывали с помощью ANOVA; * обозначает P<0,01.

На фигуре 8 показана экспрессия CD19 в клетках опухоли пациента. CD138+CD45dim клетки опухоли окрашивали на CD19 (ось x) и CD38 (ось y).

ПОДРОБНОЕ ОПИСАНИЕ

Определения

Если не указано иное, все технические и научные термины, используемые в настоящем документе, имеют то же значение, которое им обычно придают специалисты в области, к которой относится изобретение.

Единственное число существительных соответствует грамматической форме «один или более чем один» (то есть, по меньшей мере один) объектов. В качестве примера, «элемент» означает один элемент или более чем один элемент.

Выражение «примерно», используемое применительно к измеряемой величине, такой как количество, временная продолжительность и тому подобное, охватывает вариации в пределах примерно ±20% или в некоторых случаях ±10%, или в некоторых случаях ±5%, или в некоторых случаях ±1%, или в некоторых случаях ±0,1% от указанного значения, поскольку такие вариации являются подходящими для осуществления описанных способов.

Термин «химерный антигенный рецептор» или, альтернативно, «CAR» относится к рекомбинантной полипептидной конструкции, содержащей по меньшей мере внеклеточный антигенсвязывающий домен, трансмембранный домен и цитоплазматический сигнальный домен (также называемый в настоящем документе «внутриклеточным сигнальным доменом»), содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы, описанной ниже. В одном аспекте стимулирующая молекула представляет собой дзета-цепь, связанную с T-клеточным рецепторным комплексом. В одном аспекте цитоплазматический сигнальный домен дополнительно содержит один или более функциональных сигнальных доменов, полученных из по меньшей мере одной костимулирующей молекулы, описанной ниже. В одном аспекте костимулирующую молекулу выбирают из 4-1BB (то есть, CD137), CD27 и/или CD28. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий функциональный сигнальный домен, полученный из костимулирующей молекулы, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий два функциональных сигнальных домена, полученных из одной или более костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR представляет собой химерный слитый белок, содержащий внеклеточный узнающий антиген домен, трансмембранный домен и внутриклеточный сигнальный домен, содержащий по меньшей мере два функциональных сигнальных домена, полученных из одной или более костимулирующих молекул, и функциональный сигнальный домен, полученный из стимулирующей молекулы. В одном аспекте CAR содержит необязательную лидерную последовательность на амино-конце (N-конце) слитого белка CAR. В одном аспекте CAR дополнительно содержит лидерную последовательность на N-конце внеклеточного узнающего антиген домена, при этом лидерная последовательность необязательно отщепляется от узнающего антиген домена (например, scFv) во время клеточного процессинга и локализации CAR на клеточной мембране.

Термин «сигнальный домен» относится к функциональной части белка, которая действует путем передачи информации в клетке для регуляции клеточной активности с помощью определенных сигнальных путей, генерируя вторичные мессенджеры или действуя в качестве эффекторов, отвечая на такие мессенджеры.

Используемый в настоящем документе термин «CD19» означает белок кластера дифференцировки 19, который представляет собой антигенную детерминанту, находящуюся на лейкозных клетках-предшественниках. Аминокислотные и нуклеотидные последовательности человека и мыши можно найти в общедоступной базе данных, такой как, GenBank, UniProt и Swiss-Prot. Например, аминокислотную последовательность человеческого CD19 можно найти под в UniProt/Swiss-Prot под регистрационным № P15391 и нуклеотидную последовательность, кодирующую человеческий CD19, можно найти под регистрационным № NM_001178098. CD19 экспрессируется на большинстве раковых клеток B-клеточной линии дифференцировки, включая, например, острый лимфобластный лейкоз, хронический лимфоцитарный лейкоз и неходжскинскую лимфому. Другие клетки, экспрессирующие CD19, приведены ниже, где дается определение «заболеванию, ассоциированному с экспрессией CD19». Он также является ранним маркером предшественников B-клеток. Смотри, например, Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997). В одном аспекте антигенсвязывающая часть CART узнает и связывает антиген во внеклеточном домене белка CD19. В одном аспекте белок CD19 экспрессируется на раковой клетке.

Используемый в настоящем документе термин «антитело» означает белок или полипептидную последовательность, полученную из молекулы иммуноглобулина, которая специфически связывается с антигеном. Антитела могут быть поликлональными или моноклональными, содержать несколько или одну цепь, или быть интактными иммуноглобулинами, и могут быть получены из природных источников или из рекомбинантных источников. Антитела могут представлять собой тетрамеры молекул иммуноглобулинов.

Термин «фрагмент антитела» означает по меньшей мере одну часть интактного антитела, или его рекомбинантных вариантов, и относится к антигенсвязывающему домену, например, связывающей антиген вариабельной области интактного антитела, достаточной для обеспечения узнавания и специфического связывания фрагмента антитела с мишенью, такой как антиген. Примеры фрагментов антитела включают, но не ограничиваются ими, Fab, Fab', F(ab')2, и Fv фрагменты, scFv фрагменты антитела, линейные антитела, однодоменные антитела, такие как одАт (sdAb) (либо VL, либо VH), домены VHH верблюдовых и мультиспецифические антитела, образованные из фрагментов антител. Термин «scFv» означает слитый белок, который содержит по меньшей мере один фрагмент антитела, содержащий вариабельную область легкой цепи, и по меньшей мере один фрагмент антитела, содержащий вариабельную область тяжелой цепи, при этом вариабельные области легкой и тяжелой цепи связаны последовательно с помощью короткого гибкого полипептидного линкера, и который может экспрессироваться в виде одноцепочечного полипептида, при этом scFv сохраняет специфичность интактного антитела, из которого он был получен. Если не указано иное, описанный в настоящем документе scFv может иметь вариабельные области VL и VH в любом порядке, например, в направлении от N-конца к C-концу полипептида scFv может содержать VL-линкер-VH или может содержать VH-линкер-VL.

Часть композиции CAR по изобретению, содержащего антитело или фрагмент этого антитела, может существовать в различных формах, в которых антигенсвязывающий домен экспрессируется в виде части непрерывной полипептидной цепи, включая, например, однодоменный фрагмент антитела (sdAb), одноцепочечное антитело (scFv) и гуманизированное антитело (Harlow et al., 1999, In: Using Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, NY; Harlow et al., 1989, In: Antibodies: A Laboratory Manual, Cold Spring Harbor, New York; Houston et al., 1988, Proc. Natl. Acad. Sci. USA 85: 5879-5883; Bird et al., 1988, Science 242: 423-426). В одном аспекте антигенсвязывающий домен композиции CAR по изобретению содержит фрагмент антитела. В другом аспекте CAR содержит фрагмент антитела, представляющий собой scFv.

Термин «тяжелая цепь антитела» означает большую по размеру из полипептидных цепей двух типов, присутствующих в молекулах антител в естественных конформациях, и которая, как правило, определяет класс, к которому относится антитело.

Термин «легкая цепь антитела» означает меньшую по размеру из полипептидных цепей двух типов, присутствующих в молекулах антител в естественных конформациях. Легкие цепи каппа (κ) и лямбда (λ) относятся к двум основным изотипам легких цепей антитела.

Термин «рекомбинантное антитело» означает антитело, которое получено с использованием технологии рекомбинантной ДНК, такое как, например, антитело, экспрессированное в системе экспрессии бактериофагов или дрожжей. Термин также должен означать антитело, которое было получено путем синтеза молекулы ДНК, кодирующей антитело, и с этой молекулы ДНК осуществляется экспрессия белка антитела или аминокислотной последовательности, точно определяющей антитело, при этом ДНК или аминокислотная последовательность получены с использованием технологий рекомбинантной ДНК или аминокислотной последовательности, которые доступны и широко известны в данной области.

Термин «антиген» или «Ag» означает молекулу, которая вызывает иммунный ответ. Этот иммунный ответ может включать либо продуцирование антител, либо активацию специфических иммунологически компетентных клеток, либо и то и другое. Специалист в данной области понимает, что любая макромолекула, включая практически все белки или пептиды, может служить в качестве антигена. Кроме того, антигены могут быть получены из рекомбинантной или геномной ДНК. Специалист в данной области понимает, что любая ДНК, которая содержит нуклеотидную последовательность или частичную нуклеотидную последовательность, кодирующую белок, вызывающий иммунный ответ, таким образом, кодирует «антиген» в соответствии с определением, используемым в настоящем документе. Кроме того, специалист в данной области понимает, что антиген не обязательно должен кодироваться исключительно полноразмерной нуклеотидной последовательностью гена. Очевидно, что настоящее изобретение включает, но без ограничения, использование частичной нуклеотидной последовательности более чем одного гена, и что эти нуклеотидные последовательности расположены в различных комбинациях для кодирования полипептидов, которые вызывают желательный иммунный ответ. Более того, специалист в данной области понимает, что антиген вовсе не обязательно должен кодироваться «геном». Очевидно, что антиген может быть синтезирован или может быть получен из биологического образца, или может быть другой макромолекулой помимо полипептида. Такой биологический образец может включать, но не ограничивается ими, образец ткани, образец опухоли, клетку или жидкость с другими биологическими компонентами.

Термин «противоопухолевый эффект» означает биологический эффект, который может проявляться различными способами, включая, но не ограничиваясь ими, например, уменьшение объема опухоли, уменьшение количества клеток опухоли, уменьшение количества метастазов, увеличение ожидаемой продолжительности жизни, уменьшение пролиферации клеток опухоли, уменьшение выживаемости клеток опухоли или ослабление различных физиологических симптомов, ассоциированных с раком. «Противоопухолевый эффект» также может проявляться за счет способности пептидов, полинуклеотидов, клеток и антител по изобретению изначально предотвращать возникновение опухоли.

Термин «аутологичный» относится к любому материалу, полученному от того же индивидуума, которому он впоследствии будет повторно введен.

Термин «аллогенный» относится к любому материалу, полученному от другого животного того же вида, что и индивидуум, которому вводят материал. Говорят, что два или более индивидуумов являются аллогенными по отношению друг к другу, когда гены в одном или более локусах не идентичны. В некоторых аспектах аллогенный материал от индивидуумов одного и того же вида может в достаточной степени различаться генетически, чтобы являться антигенным.

Термин «ксеногенный» относится к трансплантату, полученному от животного другого вида.

Термин «рак» относится к заболеванию, характеризующемуся быстрым и неконтролируемым ростом аберрантных клеток. Раковые клетки могут распространяться локально или через кровеносную и лимфатическую систему к другим частям тела. Примеры различных видов рака описаны в настоящем документе и включают, но не ограничиваются ими, рак молочной железы, рак предстательной железы, рак яичников, рак шейки матки, рак кожи, рак поджелудочной железы, колоректальный рак, рак почки, рак печени, рак головного мозга, лимфому, лейкоз, рак легкого и тому подобное.

Определение «заболевание, ассоциированное с экспрессией CD19» охватывает, но не ограничивается ими, заболевание, ассоциированное с экспрессией CD19, или состояние, ассоциированное с клетками, которые экспрессируют CD19, включая, например, пролиферативные заболевания, такие как рак или злокачественное новообразование, или предраковое состояние, такое как миелодисплазия, миелодиспластический синдром или предлейкоз, или не относящиеся к раку симптомы, ассоциированные с клетками, которые экспрессируют CD19. В одном аспекте рак, ассоциированный с экспрессией CD19, представляет собой рак крови. В одном аспекте рак крови представляет собой лейкоз или лимфому. В одном аспекте рак, ассоциированный с экспрессией CD19, включает формы рака и злокачественные новообразования, в том числе, но не ограничиваясь ими, например, одну или более форм острого лейкоза, включая, но не ограничиваясь ими, например, В-клеточный острый лимфобластный лейкоз («BALL»), T-клеточный острый лимфобластный лейкоз («TALL»), острый лимфобластный лейкоз (ALL); одну или более форм хронического лейкоза, включая, но не ограничиваясь ими, хронический миелогенный лейкоз (CML), хронический лимфоцитарный лейкоз (CLL). Другие формы рака крови или патологические состояния крови, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, B-клеточный пролимфоцитарный лейкоз, новообразование из бластных плазмоцитоидных дендритных клеток, лимфому Беркитта, диффузную B-крупноклеточную лимфому, фолликулярную лимфому, волосатоклеточный лейкоз, мелкоклеточную или крупноклеточную фолликулярную лимфому, злокачественные лимфопролиферативные состояния, лимфому MALT-типа, лимфому из клеток мантийной зоны, лимфому из клеток маргинальной зоны, множественную миелому, миелодисплазию и миелодиспластический синдром, неходжскинскую лимфому, плазмабластную лимфому, новообразование из плазмоцитоидных дендритных клеток, макроглобулинемию Вальденстрема и «предлейкоз», представляющие собой разнообразную коллекцию патологических состояний крови, которые объединяет неэффективное производство (или дисплазия) миелоидных клеток крови, и тому подобное. Другие заболевания, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, атипичные и/или неклассические формы рака, злокачественные новообразования, предраковые состояния или пролиферативные заболевания, ассоциированные с экспрессией CD19. Не относящиеся к раку симптомы, ассоциированные с экспрессией CD19, включают, но не ограничиваются ими, например, аутоиммунное заболевание (например, волчанку), воспалительные заболевания (аллергию и астму) и трансплантацию.

Термин «консервативные модификации последовательности» относится к аминокислотным модификациям, которые существенно не влияют или не изменяют характеристики связывания антитела или фрагмента антитела, содержащего аминокислотную последовательность. Такие консервативные модификации включают аминокислотные замены, добавления и делеции. Модификации можно вносить в антитело или фрагмент антитела по изобретению стандартными методами, известными в данной области, такими как сайт-направленный мутагенез и ПЦР-опосредованный мутагенез. Консервативные аминокислотные замены представляют собой такие замены, при которых аминокислотный остаток заменяется аминокислотным остатком, имеющим аналогичную боковую цепь. Семейства аминокислотных остатков, имеющих аналогичные боковые цепи, известны в данной области. Эти семейства включают аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин, триптофан), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин). Таким образом, один или более аминокислотных остатков в CAR по изобретению можно заменять другими аминокислотными остатками из семейства остатков с такими же боковыми цепями, и измененный CAR можно тестировать с использованием функциональных анализов, описанных в настоящем документе.

Термин «стимуляция» означает первичный ответ, индуцированный связыванием стимулирующей молекулы (например, комплекса TCR/CD3) с родственным ей лигандом, тем самым опосредуется событие передачи сигнала, такое как, но без ограничения, передача сигнала через комплекс TCR/CD3. Стимуляция может опосредовать изменение экспрессии некоторых молекул, например, понижающую регуляцию TGF-β, и/или реорганизацию структур цитоскелета и тому подобное.

Термин «стимулирующая молекула» означает молекулу, экспрессируемую T-клеткой, которая обеспечивает основную цитоплазматическую сигнальную последовательность(и), регулирующие основную активацию комплекса TCR стимулирующим образом для по меньшей мере некоторых аспектов T-клеточного сигнального пути. В одном аспекте основной сигнал инициируется, например, связыванием комплекса TCR/CD3 с молекулой MHC, нагруженной пептидом, что приводит к опосредованию T-клеточного ответа, включая, но без ограничения, пролиферацию, активацию, дифференцировку и тому подобное. Основная цитоплазматическая сигнальная последовательность (также называемая «основным сигнальным доменом»), которая действует стимулирующим образом, может содержать сигнальный мотив, который известен как тирозин-содержащий мотив активации иммунных рецепторов или ITAM. Примеры ITAM-содержащих основных цитоплазматических сигнальных последовательностей, которые особенно полезны для данного изобретения, включают, но не ограничиваются ими, те, которые получены из TCR-дзета, FcR-гамма, FcR-бета, CD3-гамма, CD3-дельта, CD3-эпсилон, CD5, CD22, CD79a, CD79b, CD278 (также известного как «ICOS») и CD66d. В конкретных CAR по изобретению внутриклеточный сигнальный домен в любом одном или более CAR по изобретению содержит внутриклеточную сигнальную последовательность, например, основную сигнальную последовательность CD3-дзета. В конкретных CAR по изобретению основная сигнальная последовательность CD3-дзета представляет собой последовательность, приведенную в SEQ ID NO: 17, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного. В конкретном CAR по изобретению основная сигнальная последовательность CD3-дзета представляет собой последовательность, приведенную в SEQ ID NO: 43, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного.

Термин «антигенпредставляющая клетка» или «АПК» относится к клетке иммунной системы, такой как вспомогательная клетка (например, B-клетка, дендритная клетка и тому подобное), которая экспонирует чужеродный антиген в комплексе с главными комплексами гистосовместимости (MHC) на своей поверхности. T-клетки могут узнавать эти комплексы при помощи их T-клеточных рецепторов (TCR). АПК процессируют антигены и представляют их T-клеткам.

Используемый в настоящем документе термин «внутриклеточный сигнальный домен» означает внутриклеточную часть молекулы. Внутриклеточный сигнальный домен генерирует сигнал, который стимулирует иммунную эффекторную функцию CAR-содержащей клетки, например, CART-клетки. Примеры иммунной эффекторной функции, например, в CART-клетке, включают цитолитическую активность и хелперную активность, в том числе секрецию цитокинов.

В одном из вариантов осуществления внутриклеточный сигнальный домен может содержать основной внутриклеточный сигнальный домен. Иллюстративные основные внутриклеточные сигнальные домены включают те, которые получены из молекул, ответственных за основную стимуляцию или антиген-зависимую стимуляцию. В одном из вариантов осуществления внутриклеточный сигнальный домен может содержать костимулирующий внутриклеточный домен. Иллюстративные костимулирующие внутриклеточные сигнальные домены включают те, которые получены из молекул, ответственных за костимулирующие сигналы или антиген-независимую стимуляцию. Например, в случае CART основной внутриклеточный сигнальный домен может содержать цитоплазматическую последовательность T-клеточного рецептора, и костимулирующий внутриклеточный сигнальный домен может содержать цитоплазматическую последовательность из корецептора или костимулирующей молекулы.

Основной внутриклеточный сигнальный домен может содержать сигнальный мотив, который известен как тирозин-содержащий мотив активации иммунных рецепторов или ITAM. Примеры ITAM-содержащих основных цитоплазматических сигнальных последовательностей включают, но не ограничиваются ими, те, которые получены из CD3-дзета, FcR-гамма, FcR-бета, CD3-гамма, CD3-дельта, CD3-эпсилон, CD5, CD22, CD79a, CD79b, а также CD66d DAP10 и DAP12.

Термин «дзета» или, альтернативно, «дзета-цепь», «CD3-дзета» или «TCR-дзета» относится к белку, имеющему регистрационный № GenBan BAG36664.1, или эквивалентным остаткам из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного, и «стимулирующий домен дзета» или, альтернативно, «стимулирующий домен CD3-дзета» или «стимулирующий домен TCR-дзета» определяют как аминокислотные остатки из цитоплазматического домена дзета-цепи, которые достаточны для функциональной передачи первичного сигнала, необходимого для активации T-клетки. В одном аспекте цитоплазматический домен дзета содержит остатки с 52 по 164 в белке с регистрационным № GenBank BAG36664.1 или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного, которые являются его функциональными ортологами. В одном аспекте «стимулирующий домен дзета» или «стимулирующий домен CD3-дзета» представляет собой последовательность, приведенную в SEQ ID NO: 17. В одном аспекте «стимулирующий домен дзета» или «стимулирующий домен CD3-дзета» представляет собой последовательность, приведенную в SEQ ID NO: 43.

Термин «костимулирующая молекула» относится к родственному связывающемуся партнеру на T-клетке, который специфически связывается с костимулирующим лигандом, тем самым опосредуя костимулирующий ответ T-клетки, такой как, но без ограничения, пролиферация. Костимулирующие молекулы представляют собой молекулы клеточной поверхности, отличные от рецепторов антигена или их лигандов, которые необходимы для эффективного иммунного ответа. Костимулирующие молекулы включают, но не ограничиваются ими, молекулы MHC класса I, BTLA и Toll-подобный рецептор, а также OX40, CD2, CD27, CD28, CDS, ICAM-1, LFA-1 (CD11a/CD18) и 4-1BB (CD137).

Костимулирующий внутриклеточный сигнальный домен может представлять собой внутриклеточную часть костимулирующей молекулы. Костимулирующая молекула может быть представлена в следующих семействах белков: белки-рецепторы TNF, иммуноглобулиноподобные белки, рецепторы цитокинов, интегрины, сигнальные молекулы активации лимфоцитов (белки SLAM) и активирующие NK-клетки рецепторы. Примеры таких молекул включают CD27, CD28, 4-1BB (CD137), OX40, GITR, CD30, CD40, ICOS, BAFFR, HVEM, ассоциированный с функцией лимфоцитов антиген-1 (LFA-1), CD2, CD7, LIGHT, NKG2C, SLAMF7, NKp80, CD160, B7-H3, лиганд, который специфически связывается с CD83, и тому подобное.

Внутриклеточный сигнальный домен может содержать всю внутриклеточную часть, или весь нативный внутриклеточный сигнальный домен, молекулы, из которой он получен, либо ее функциональный фрагмент.

Термин «4-1BB» относится к члену суперсемейства TNFR с аминокислотной последовательностью, имеющей регистрационный № GenBank AAA62478.2, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного; и «костимулирующий домен 4-1BB» определяют как аминокислотные остатки 214-255 белка с регистрационным № GenBank AAA62478.2, или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного. В одном аспекте «костимулирующий домен 4-1BB» представляет собой последовательность, приведенную в SEQ ID NO: 16 или эквивалентные остатки из видов, отличных от человека, например, мышей, грызунов, обезьян, человекообразных обезьян и тому подобного.

Термин «кодирующий» относится к внутреннему свойству определенных последовательностей нуклеотидов в полинуклеотиде, таком как ген, кДНК или мРНК, служить в качестве матриц для синтеза в биологических процессах других полимеров и макромолекул, имеющих либо определенную последовательность нуклеотидов (например, рРНК, тРНК и мРНК), либо определенную последовательность аминокислот и вытекающие из этого биологические свойства. Таким образом, ген, кДНК или РНК кодирует белок, если транскрипция и трансляция мРНК, соответствующей данному гену, приводит к образованию белка в клетке или другой биологической системе. Как кодирующая цепь, нуклеотидная последовательность которой идентична последовательности мРНК и, как правило, приводится в списках последовательностей, так и некодирующая цепь, используемая в качестве матрицы для транскрипции гена или кДНК, может быть названа кодирующей белок или другой продукт данного гена или кДНК.

Если не указано иное, выражение «нуклеотидная последовательность, кодирующая аминокислотную последовательность» подразумевает все нуклеотидные последовательности, которые являются вырожденными вариантами друг друга и которые кодируют одну и ту же аминокислотную последовательность. Выражение «нуклеотидная последовательность, кодирующая белок или РНК» может также включать интроны в случае, если нуклеотидная последовательность, кодирующая белок, может в некоторых вариантах содержать интрон(ы).

Термины «эффективное количество» или «терапевтически эффективное количество» используются в настоящем документе взаимозаменяемо и относятся к количеству соединения, препарата, материала или композиции, описанных в настоящем документе, которое эффективно для достижения конкретного биологического результата.

Термин «эндогенный» относится к любому материалу, полученному из, или продуцируемому в организме, клетке, ткани или системе.

Термин «экзогенный» относится к любому материалу, введенному извне или продуцируемому вне организма, клетки, ткани или системы.

Термин «экспрессия» означает транскрипцию и/или трансляцию конкретной нуклеотидной последовательности, управляемую промотором.

Термин «вектор переноса» означает композицию химически связанных компонентов, содержащую выделенную нуклеиновую кислоту, которую можно использовать для доставки выделенной нуклеиновой кислоты внутрь клетки. Множество векторов известно в данной области, включая, но не ограничиваясь ими, линейные полинуклеотиды, полинуклеотиды, связанные с ионными или амфифильными соединениями, плазмиды и вирусы. Таким образом, термин «вектор переноса» включает автономно реплицирующуюся плазмиду или вирус. Следует понимать, что термин также включает не-плазмидные и не-вирусные соединения, которые облегчают перенос нуклеиновой кислоты в клетки, такие как, например, соединение полилизина, липосомы и тому подобное. Примеры вирусных векторов переноса включают, но не ограничиваются ими, аденовирусные векторы, аденоассоциированные вирусные векторы, ретровирусные векторы, лентивирусные векторы и тому подобное.

Термин «экспрессионный вектор» означает вектор, содержащий рекомбинантный полинуклеотид, содержащий последовательности контроля экспрессии, функционально связанные с экспрессируемой нуклеотидной последовательностью. Экспрессионный вектор содержит достаточно цис-действующих элементов для экспрессии; другие элементы для экспрессии могут быть представлены клеткой-хозяином или присутствовать в in vitro системе экспрессии. Экспрессионные векторы включают все, которые известны в данной области, в том числе космиды, плазмиды (например, «голые» или содержащиеся в липосомах) и вирусы (например, лентивирусы, ретровирусы, аденовирусы и аденоассоциированные вирусы), которые включают рекомбинантный полинуклеотид.

Термин «лентивирус» служит для обозначения рода семейства Retroviridae. Лентивирусы являются уникальными среди ретровирусов тем, что они способны инфицировать неделящиеся клетки; они способны доставлять значительное количество генетической информации в ДНК клетки-хозяина, таким образом, они являются одним из наиболее эффективных вариантов вектора для доставки генов. HIV, SIV и FIV являются примерами лентивирусов.

Термин «лентивирусный вектор» относится к вектору, полученному из по меньшей мере части лентивирусного генома, включая, в частности, самоинактивирующийся лентивирусный вектор, предложенный в статье Milone et al., Mol. Ther. 17(8): 1453-1464 (2009). Другие примеры лентивирусных векторов, которые могут быть использованы в клинической практике, включают, но не ограничиваются ими, например, технологию доставки генов LENTIVECTOR® от компании Oxford BioMedica, векторную систему LENTIMAX™ от компании Lentigen и тому подобное. Не применяемые в клинической практике виды лентивирусных векторов также доступны и известны специалистам в данной области.

Термин «гомологичные» или «идентичность» относится к идентичности последовательностей субъединиц между двумя полимерными молекулами, например, между двумя молекулами нуклеиновой кислоты, например, двумя молекулами ДНК или двумя молекулами РНК, или между двумя полипептидными молекулами. Если положение субъединицы в обеих из двух молекул занято одной и той же мономерной субъединицей, например, если положение в каждой из двух молекул ДНК занято остатком аденина, тогда они являются гомологичными или идентичными по данному положению. Гомология между двумя последовательностями напрямую зависит от числа совпадающих или гомологичных положений; например, если половина положений (например, пять положений в полимере длиной десять субъединиц) в двух последовательностях являются гомологичными, то две последовательности являются гомологичными на 50%; если 90% положений (например, 9 из 10), являются совпадающими или гомологичными, то две последовательности являются гомологичными на 90%.

«Гуманизированные» формы антител, отличных от человеческих (например, мышиных), представляют собой химерные иммуноглобулины, цепи иммуноглобулинов или их фрагменты (такие как Fv, Fab, Fab', F(ab')2, или другие антигенсвязывающие подпоследовательности антител), которые содержат минимальную последовательность, происходящую из иммуноглобулина, не принадлежащего человеку. По большей части, гуманизированные антитела и фрагменты антител представляют собой человеческие иммуноглобулины (реципиентное антитело или фрагмент антитела), в которых остатки из определяющей комплементарность области (CDR) реципиента заменены на остатки из CDR видов, отличных от человека (донорское антитело), например, мыши, крысы или кролика, имеющие нужную специфичность, аффинность и функциональную возможность. В некоторых случаях остатки каркасной области Fv (FR) человеческого иммуноглобулина заменены соответствующими остатками, не принадлежащими человеку. Более того, гуманизированное антитело/фрагмент антитела может содержать остатки, которые не встречаются ни в реципиентном антителе, ни в привнесенных последовательностях CDR или каркаса. Такие модификации способны дополнительно усовершенствовать и оптимизировать эффективность антитела или фрагмента антитела. Как правило, гуманизированное антитело или фрагмент этого антитела будет содержать практически все из по меньшей мере одного, и как правило, двух вариабельных доменов, в которых все или практически все из областей CDR, соответствующие таковым из иммуноглобулина, отличного от человеческого, и все или значительная часть из областей FR являются последовательностями человеческого иммуноглобулина. Гуманизированное антитело или фрагмент антитела может также содержать по меньшей мере часть константной области (Fc) иммуноглобулина, как правило, человеческого иммуноглобулина. Для получения более подробной информации, смотри Jones et al., Nature, 321: 522-525, 1986; Reichmann et al., Nature, 332: 323-329, 1988; Presta, Curr. Op. Struct. Biol., 2: 593-596, 1992.

Термин «полностью человеческий» относится к иммуноглобулину, такому как антитело или фрагмент антитела, в случае, когда целая молекула происходит из организма человека или состоит из аминокислотной последовательности, идентичной человеческой форме антитела или иммуноглобулина.

Термин «выделенный» означает измененный или удаленный из естественного окружения. Например, нуклеиновая кислота или пептид, естественным образом присутствующие в организме животного, не являются «выделенными», однако та же нуклеиновая кислота или тот же пептид, частично или полностью отделенные от присутствующих естественным образом в их окружении материалов, являются «выделенными». Выделенная нуклеиновая кислота или белок может существовать в практически очищенной форме или может существовать в неестественном для нее/него окружении, таком как, например, клетка-хозяин.

В контексте настоящего изобретения использованы следующие сокращения для часто встречающихся оснований нуклеиновой кислоты. «A» означает аденозин, «C» означает цитозин, «G» означает гуанозин, «T» означает тимидин и «U» означает уридин.

Термины «функционально связанные» или «транскрипционный контроль» относятся к функциональной связи между регуляторной последовательностью и гетерологичной нуклеотидной последовательностью, результатом чего является экспрессия последней. Например, первая нуклеотидная последовательность является функционально связанной со второй нуклеотидной последовательностью, если первая нуклеотидная последовательность находится в функциональной связи со второй нуклеотидной последовательностью. Например, промотор функционально связан с кодирующей последовательностью, если промотор влияет на транскрипцию или экспрессию кодирующей последовательности. Функционально связанные последовательности ДНК могут быть смежными друг с другом и, например, если необходимо соединить две кодирующие белок области, находиться в одной и той же рамке считывания.

Термин «парентеральное» введение иммуногенной композиции включает, например, подкожную (п/к), внутривенную (в/в), внутримышечную (в/м) или интрастернальную инъекцию, способы внутриопухолевого введения или инфузию.

Термины «нуклеиновая кислота» или «полинуклеотид» относятся к дезоксирибонуклеиновым кислотам (ДНК) или рибонуклеиновым кислотам (РНК), а также их полимерам, как в одноцепочечной, так и в двухцепочечной форме. Если нет конкретных ограничений, термин охватывает нуклеиновые кислоты, содержащие известные аналоги природных нуклеотидов, которые имеют свойства связывания, аналогичные таковым у эталонной нуклеиновой кислоты, и метаболизируются аналогично природным нуклеотидам. Если нет иных указаний, конкретная последовательность нуклеиновой кислоты также косвенно охватывает ее консервативно модифицированные варианты (например, замены вырожденных кодонов), аллели, ортологи, ОНП (SNP) и комплементарные последовательности, а также последовательность, указанную в явной форме. В частности, замены вырожденных кодонов можно осуществлять путем создания последовательностей, в которых в третьем положении одного или более выбранных (или всех) кодонов имеет место замена смешанными основаниями и/или остатками дезоксиинозина (Batzer et al., Nucleic Acid Res. 19: 5081 (1991); Ohtsuka et al., J. Biol. Chem. 260: 2605-2608 (1985) и Rossolini et al., Mol. Cell. Probes 8: 91-98 (1994)).

Термины «пептид», «полипептид» и «белок» используются взаимозаменяемо и относятся к соединению, состоящему из аминокислотных остатков, ковалентно связанных пептидными связями. Белок или пептид должен содержать по меньшей мере две аминокислоты, и никаких ограничений не накладывается на максимальное количестве аминокислот, которые могут составлять белковую или пептидную последовательность. Полипептиды включают любой пептид или белок, содержащий две или более аминокислот, связанных друг с другом пептидными связями. Используемый в настоящем документе термин относится как к коротким цепям, которые также обычно называются в данной области пептидами, олигопептидами и олигомерами, например, так и к более длинным цепям, как правило, называемым в данной области белками, которые бывают самых разных типов. «Полипептиды» включают, например, биологически активные фрагменты, в значительной степени гомологичные полипептиды, олигопептиды, гомодимеры, гетеродимеры, варианты полипептидов, модифицированные полипептиды, производные, аналоги, слитые белки, в числе прочих. Полипептид включает природный пептид, рекомбинантный пептид или их сочетание.

Термин «промотор» означает последовательность ДНК, узнаваемую синтетическим аппаратом клетки или привнесенным синтетическим аппаратом, необходимую для инициации специфической транскрипции полинуклеотидной последовательности.

Термин «промотор/регуляторная последовательность» означает нуклеотидную последовательность, которая необходима для экспрессии продукта гена, функционально связанного с промотором/регуляторной последовательностью. В некоторых случаях данная последовательность может представлять собой базовую последовательность промотора, а в других случаях данная последовательность может также включать последовательность энхансера и другие регуляторные элементы, необходимые для экспрессии продукта гена. Промотор/регуляторная последовательность может, например, быть последовательностью, которая приводит к экспрессии продукта гена тканеспецифичным образом.

Термин «конститутивный» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена при большинстве или всех физиологических условиях в клетке.

Термин «индуцируемый» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена практически только тогда, когда соответствующий промотору индуктор присутствует в клетке.

Термин «тканеспецифичный» промотор означает нуклеотидную последовательность, которая, будучи функционально связанной с полинуклеотидом, кодирующим или определяющим продукт гена, вызывает продуцирование в клетке продукта гена практически только в том случае, если клетка является клеткой ткани, тип которой соответствует промотору.

Термин «гибкий полипептидный линкер» или «линкер», используемый в контексте scFv, означает пептидный линкер, состоящий из таких аминокислот, как остатки глицина и/или серина, используемые отдельно или в сочетании для связывания вместе вариабельной области тяжелой цепи и вариабельной области легкой цепи. В одном варианте осуществления гибкий полипептидный линкер представляет собой Gly/Ser линкер и содержит аминокислотную последовательность (Gly-Gly-Gly-Ser)n, where n является положительным целым числом, равным или большим, чем 1. Например, n=1, n=2, n=3, n=4, n=5 и n=6, n=7, n=8, n=9 и n=10 (SEQ ID NO: 105). В одном варианте осуществления гибкие полипептидные линкеры включают, но не ограничиваются ими, (Gly4 Ser)4 (SEQ ID NO: 106) или (Gly4 Ser)3 (SEQ ID NO: 107). В другом варианте осуществления линкеры включают несколько повторов из (Gly2Ser), (GlySer) или (Gly3Ser) (SEQ ID NO: 108). В объем изобретения также входят линкеры, описанные в WO 2012/138475, содержание которого включено в настоящий документ посредством ссылки).

Используемый в настоящем документе термин «5'-кэп» (также называемый РНК кэп, РНК 7-метилгуанозиновый кэп или РНК m7G кэп) представляет собой модифицированный гуаниновый нуклеотид, который был добавлен «впереди» или на 5'-конце эукариотической матричной РНК вскоре после начала транскрипции. 5'-кэп состоит из концевой группы, которая связана с первым транскрибируемым нуклеотидом. Его присутствие является критическим для узнавания рибосомой и защиты от РНКаз. Добавление кэпа связано с транскрипцией и происходит котранскрипционно так, что каждое из событий влияет на другое. Вскоре после начала транскрипции 5'-конец синтезируемой мРНК связывается кэп-синтезирующим комплексом, связанным с РНК-полимеразой. Этот ферментативный комплекс катализирует химические реакции, которые необходимы для кэппирования мРНК. Синтез протекает как многостадийная биохимическая реакция. Кэппирующий фрагмент можно модифицировать для модулирования функциональных свойств мРНК, таких как ее стабильность или эффективность трансляции.

Используемый в настоящем документе термин «in vitro транскрибированная РНК» означает РНК, предпочтительно мРНК, которая была синтезирована in vitro. Как правило, in vitro транскрибированная РНК образуется из in vitro транскрипционного вектора. In vitro транскрипционный вектор содержит матрицу, используемую для создания in vitro транскрибированной РНК.

Используемый в настоящем документе термин «поли(A)» означает серию остатков аденозина, присоединенных в процессе полиаденилирования к мРНК. В предпочтительном варианте осуществления конструкции для временной экспрессии полиA составляет от 50 до 5000 (SEQ ID NO: 109), предпочтительно более 64, более предпочтительно более 100, наиболее предпочтительно более 300 или 400. Поли(A) последовательности можно модифицировать химически или ферментативно для модулирования функциональных свойств мРНК, таких как локализация, стабильность или эффективность трансляции.

Используемый в настоящем документе термин «полиаденилирование» означает ковалентное связывание полиаденилового фрагмента или его модифицированного варианта с молекулой матричной РНК. У эукариотических организмов большинство молекул матричной РНК (мРНК) являются полиаденилированными на 3'-конце. 3'-поли(A) последовательность представляет собой длинную последовательность адениновых нуклеотидов (часто нескольких сотен), добавленную к пре-мРНК за счет действия фермента полиаденилат полимеразы. У высших эукариот поли(A) последовательность добавлена к транскриптам, которые содержат определенную последовательность, сигнал полиаденилирования. Поли(A) последовательность и белок, связанный с ней, способствуют защите мРНК от деградации экзонуклеазами. Полиаденилирование также важно для терминации транскрипции, выхода мРНК из ядра и трансляции. Полиаденилирование происходит в ядре сразу после транскрипции ДНК в РНК, но, кроме того, также может происходить позже в цитоплазме. После завершения транскрипции цепь мРНК отщепляется за счет действия эндонуклеазного комплекса, связанного с РНК-полимеразой. Сайт расщепления, как правило, характеризуется наличием последовательности оснований AAUAAA рядом с сайтом расщепления. После отщепления мРНК остатки аденозина добавляются к свободному 3'-концу на сайте расщепления.

Используемый в настоящем документе термин «временная» относится к экспрессии неинтегрированного трансгена в течение нескольких часов, дней или недель, при этом период времени экспрессии является короче, чем период времени для экспрессии гена, если он интегрирован в геном или находится в стабильном плазмидном репликоне в клетке-хозяине.

Термин «путь сигнальной трансдукции» означает биохимическое взаимодействие между различными молекулами сигнальной трансдукции, которые играют роль в передаче сигнала из одной части клетки в другую часть клетки. Термин «рецептор клеточной поверхности» включает молекулы и комплексы молекул, способные получать сигнал и передавать сигнал через мембрану клетки.

Термин «субъект» включает живые организмы, в которых может быть индуцирован иммунный ответ (например, млекопитающих, человека).

Термин, «практически очищенная» клетка означает клетку, которая по существу свободна от клеток других типов. Практически очищенная клетка также означает клетку, которая была отделена от клеток других типов, с которыми она обычно связана в ее естественном состоянии. В некоторых случаях популяция практически очищенных клеток означает гомогенную популяцию клеток. В других случаях этот термин просто означает клетку, которая была отделена от клеток, с которыми она естественным образом связана в их природном состоянии. В некоторых аспектах клетки культивируют in vitro. В других аспектах клетки не культивируют in vitro.

Используемый в настоящем документе термин «терапевтический» означает лечебный. Терапевтический эффект получают путем ослабления, подавления, ремиссии или ликвидации болезненного состояния.

Используемый в настоящем документе термин «профилактика» означает предотвращение или превентивное лечение заболевания или болезненного состояния.

В контексте настоящего изобретения термины «опухолевый антиген» или «антиген гиперпролиферативного заболевания», или «антиген, ассоциированный с гиперпролиферативным заболеванием» относятся к антигенам, которые обычно характерны для определенных гиперпролиферативных заболеваний. В некоторых аспектах антигены гиперпролиферативного заболевания по настоящему изобретению получают из злокачественных опухолей, включая, но не ограничиваясь ими, первичную или метастатическую меланому, тимому, лимфому, саркому, рак легкого, рак печени, неходжскинскую лимфому, неходжкинскую лимфому, лейкозы, рак тела матки, рак шейки матки, рак мочевого пузыря, рак почки и аденокарциномы, такие как рак молочной железы, рак предстательной железы, рак яичников, рак поджелудочной железы и тому подобное.

Термин «трансфекция» или «трансформация» или «трансдукция» относится к процессу, посредством которого экзогенная нуклеиновая кислота переносится или вводится в клетку-хозяина. «Трансфицированная» или «трансформированная», или «трансдуцированная» клетка представляет собой клетку, которая была трансфицирована, трансформирована или трансдуцирована экзогенной нуклеиновой кислотой. Клетка включает первичную клетку субъекта и ее потомство.

Выражение «специфически связывает» относится к антителу, или лиганду, который узнает и связывает соответствующий белок-партнер по связыванию (например, стимулирующую и/или костимулирующую молекулу, присутствующую на T-клетке), присутствующий в образце, но при этом антитело или лиганд практически не узнает и не связывает другие молекулы в образце.

Диапазоны: в данном описании различные аспекты изобретения могут быть представлены в формате диапазона. Следует понимать, что описание в формате диапазона использовано лишь для удобства и краткости и не должно быть истолковано как негибкое ограничение объема изобретения. Соответственно, описание диапазона следует рассматривать как специально раскрывающее все возможные поддиапазоны, а также отдельные числовые значения в пределах этого диапазона. Например, описание такого диапазона, как от 1 до 6, следует рассматривать как специально раскрывающее такие поддиапазоны, как от 1 до 3, от 1 до 4, от 1 до 5, от 2 до 4, от 2 до 6, от 3 до 6 и так далее, а также отдельные числовые значения в пределах этого диапазона, например, 1, 2, 2,7, 3, 4, 5, 5,3 и 6. В качестве другого примера, такой диапазон, как 95-99% идентичности, включает нечто с идентичностью 95%, 96%, 97%, 98% или 99%, и включает такие поддиапазоны, как 96-99%, 96-98%, 96-97%, 97-99%, 97-98% и 98-99% идентичности. Это применимо независимо от ширины диапазона.

Описание

Настоящее изобретение относится к композициям и способам их применения для лечения такого заболевания, как рак, с использованием гуманизированных анти-CD19 химерных антигенных рецепторов (CAR).

В одном аспекте изобретение относится к ряду химерных антигенных рецепторов (CAR), содержащих антитело или фрагмент антитела, сконструированные для усиленного связывания с белком CD19. В одном аспекте изобретение относится к клетке (например, T-клетке), генетически измененной для экспрессии CAR, при этом CAR T-клетка («CART») проявляет противоопухолевые свойства. В одном аспекте клетка трансформирована CAR, и CAR экспрессируется на поверхности клетки. В некоторых вариантах осуществления клетка (например, Т-клетка) трансдуцирована вирусным вектором, кодирующим CAR. В некоторых вариантах осуществления вирусный вектор представляет собой ретровирусный вектор. В некоторых вариантах осуществления вирусный вектор представляет собой лентивирусный вектор. В некоторых таких вариантах осуществления клетка может стабильно экспрессировать CAR. В другом варианте осуществления клетка (например, T-клетка) трансфицирована нуклеиновой кислотой, например, мРНК, кДНК, ДНК, кодирующей CAR. В некоторых таких вариантах осуществления клетка может временно экспрессировать CAR.

В одном аспекте направленная против белка CD19 связывающая часть CAR представляет собой scFv фрагмент антитела. В одном аспекте такие фрагменты антитела являются функциональными в том отношении, что они сохраняют эквивалентную аффинность связывания, например, они связывают тот же антиген с эффективностью, сопоставимой с эффективностью IgG антитела, из которого они получены. В одном аспекте такие фрагменты антитела являются функциональными в том отношении, что они обеспечивают биологический ответ, который может включать, но не ограничивается ими, активацию иммунного ответа, ингибирование возникновения сигнальной трансдукции от его целевого антигена, ингибирование киназной активности и тому подобное, как будет понятно специалисту в данной области. В одном аспекте анти-CD19 антигенсвязывающий домен CAR представляет собой scFv фрагмент антитела, который является гуманизированным в сравнении с последовательностью scFv мышей, из которой он происходит. В одном аспекте исходная мышиная последовательность scFv представляет собой конструкцию CAR19, описанную в PCT публикации WO 2012/079000 и приведенную в настоящем документе как SEQ ID NO: 58.

В некоторых аспектах антитела по изобретению встроены в химерный антигенный рецептор (CAR). В одном аспекте CAR содержит полипептидную последовательность, приведенную как SEQ ID NO: 12 в PCT публикации WO 2012/079000 и приведенную в настоящем документе как SEQ ID NO: 58, при этом домен scFv заменен одной или более последовательностями, выбранными из SEQ ID NOS: 1-12. В одном аспекте домены scFv SEQ ID NOS: 1-12 являются гуманизированными вариантами домена scFv SEQ ID NO: 59, который представляет собой scFv фрагмент антитела мыши, который специфически связывается с человеческим CD19. Гуманизация этого мышиного scFv может быть желательной для клинического применения, когда специфичные для мыши остатки могут индуцировать человеческий иммунный ответ на мышиный антиген (HAMA) у пациентов, получающих лечение при помощи CART19, например, лечение T-клетками, трансдуцированными конструкцией CAR19.

В одном аспекте анти-CD19 связывающий домен, например, гуманизированный scFv, часть CAR по изобретению, кодируется трансгеном, последовательность которого была оптимизирована по кодонам для экспрессии в клетке млекопитающего. В одном аспекте полная конструкция CAR по изобретению кодируется трансгеном, полная последовательность которого была оптимизирована по кодонам для экспрессии в клетке млекопитающего. Оптимизация по кодонам опирается на то открытие, что частота встречаемости синонимичных кодонов (то есть, кодонов, которые кодируют одну и ту же аминокислоту) в кодирующей ДНК имеет отклонения у разных видов. Такая вырожденность кодонов приводит к тому, что один и тот же полипептид может кодироваться различными нуклеотидными последовательностями. Разнообразные способы оптимизации кодонов известны в данной области и включают, например, способы, описанные по меньшей мере в патентах США с номерами 5786464 и 6114148.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 1.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 2.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 3.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 4.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 5.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 6.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 7.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 8.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 9.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 10.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 11.

В одном аспекте гуманизированный CAR19 содержит scFv часть, приведенную в SEQ ID NO: 12.

В одном аспекте CAR по изобретению сочетают в себе антигенсвязывающий домен специфического антитела с внутриклеточной сигнальной молекулой. Например, в некоторых аспектах внутриклеточная сигнальная молекула включает, но не ограничивается ими, сигнальные модули CD3-дзета цепь, 4-1BB и CD28, а также их сочетания. В одном аспекте антигенсвязывающий домен связывается с CD19. В одном аспекте CD19 CAR представляет собой CAR, выбранный из последовательностей, приведенных в одной или более из SEQ ID NOS: 31-42. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 31. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 32. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 33. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 34. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 35. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 36. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 37. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 38. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 39. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 40. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 41. В одном аспекте CD19 CAR содержит последовательность, приведенную в SEQ ID NO: 42.

Кроме того, настоящее изобретение относится к композициям CD19 CAR и их использованию в лекарственных средствах или способах лечения, в числе прочих заболеваний, рака или любых злокачественных новообразований, или аутоиммунных заболеваний, в которые вовлечены клетки или ткани, экспрессирующие CD19.

В одном аспекте CAR по изобретению можно использовать для уничтожения CD19-экспрессирующих нормальных клеток, таким образом, они подходят для клеточной симптоматической терапии перед трансплантацией клеток. В одном аспекте CD19-экспрессирующая нормальная клетка представляет собой CD19-экспрессирующую нормальную стволовую клетку, и трансплантация клеток представляет собой трансплантацию стволовых клеток.

В одном аспекте изобретение относится к клетке (например, T-клетке), генетически измененной для экспрессии химерного антигенного рецептора (CAR), при этом CAR T-клетка («CART») проявляет противоопухолевые свойства. Предпочтительным антигеном является CD19. В одном аспекте антигенсвязывающий домен CAR содержит частично гуманизированный фрагмент анти-CD19 антитела. В одном аспекте антигенсвязывающий домен CAR содержит частично гуманизированный фрагмент анти-CD19 антитела, представляющий собой scFv. Соответственно, изобретение относится к CD19 CAR, который содержит гуманизированный анти-CD19 связывающий домен и введен генно-инженерными методами в T-клетку, а также способам его использования для адоптивной терапии.

В одном аспекте CD19 CAR содержит по меньшей мере один внутриклеточный домен, выбранный из группы, включающей сигнальный домен CD137 (4-1BB), сигнальный домен CD28, сигнальный домен CD3-дзета, а также любые их сочетания. В одном аспекте CD19 CAR содержит по меньшей мере один внутриклеточный сигнальный домен из одной или более костимулирующих молекул, отличных от CD137 (4-1BB) или CD28.

Химерный антигенный рецептор (CAR)

Настоящее изобретение относится к рекомбинантной конструкции ДНК, содержащей последовательности, кодирующие CAR, при этом CAR содержит гуманизированный фрагмент антитела, который специфически связывается с CD19, например, человеческим CD19, причем последовательность фрагмента антитела граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. Внутриклеточный сигнальный домен может содержать костимулирующий сигнальный домен и/или основной сигнальный домен, например, дзета-цепь. Костимулирующий сигнальный домен означает часть CAR, содержащую по меньшей мере часть внутриклеточного домена костимулирующей молекулы.

В конкретных аспектах конструкция CAR по изобретению содержит домен scFv, выбранный из группы, состоящей из SEQ ID NOS: 1-12, при этом перед scFv может, необязательно, находиться лидерная последовательность, такая как SEQ ID NO: 13, а после scFv может, необязательно, находиться шарнирная последовательность, такая как SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49, трансмембранная область, такая как SEQ ID NO: 15, внутриклеточный сигнальный домен, который включает SEQ ID NO: 16 или SEQ ID NO: 51, и последовательность CD3-дзета, которая включает SEQ ID NO: 17 или SEQ ID NO: 43, при этом домены являются смежными и находятся в одной рамке считывания, в результате чего образуется слитый белок. Также включена в изобретение нуклеотидная последовательность, кодирующая полипептид каждого из scFv фрагментов, выбранная из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12. Также включена в изобретение нуклеотидная последовательность, кодирующая полипептид каждого из scFv фрагментов, выбранная из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ IS NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, и каждый из доменов SEQ ID NOS: 13-17, плюс кодируемый слитый белок CD19 CAR по изобретению. В одном аспекте иллюстративные конструкции CD19 CAR содержат необязательную лидерную последовательность, внеклеточный антигенсвязывающий домен, шарнир, трансмембранный домен и внутриклеточный стимулирующий домен. В одном аспекте иллюстративная конструкция CD19 CAR содержит необязательную лидерную последовательность, внеклеточный антигенсвязывающий домен, шарнир, трансмембранный домен, внутриклеточный костимулирующий домен и внутриклеточный стимулирующий домен. Конкретные конструкции CD19 CAR, содержащие гуманизированные домены scFv по изобретению, приведены в виде SEQ ID NOS: 31-42.

Полноразмерные последовательности CAR также приведены в настоящем документе в SEQ ID NOS: 31-42, как показано в таблице 3.

Иллюстративная лидерная последовательность приведена в SEQ ID NO: 13. Иллюстративная последовательность шарнира/спейсера приведена в SEQ ID NO: 14 или SEQ ID NO: 45, или SEQ ID NO: 47, или SEQ ID NO: 49. Иллюстративная последовательность трансмембранного домена приведена в SEQ ID NO: 15. Иллюстративная последовательность внутриклеточного сигнального домена белка 4-1BB приведена в SEQ ID NO: 16. Иллюстративная последовательность внутриклеточного сигнального домена CD27 приведена в SEQ ID NO: 51. Иллюстративная последовательность домена CD3-дзета приведена в SEQ ID NO: 17 или SEQ ID NO: 43.

В одном аспекте настоящее изобретение относится к конструкции рекомбинантной нуклеиновой кислоты, содержащей молекулу нуклеиновой кислоты, кодирующую CAR, при этом молекула нуклеиновой кислоты содержит нуклеотидную последовательность, кодирующую анти-CD19 связывающий домен, например, описанный в настоящем документе, которая граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. В одном аспекте анти-CD19 связывающий домен выбран из одной или более из SEQ ID NOS: 1-12. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 последовательности, приведенной в одной или более из SEQ ID NOS: 61-72. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 61. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 62. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 63. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 64. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 65. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 66. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 67. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 68. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 69. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 70. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 71. В одном аспекте анти-CD19 связывающий домен кодируется нуклеотидными остатками 64-813 в SEQ ID NO: 72.

В одном аспекте настоящее изобретение относится к конструкции рекомбинантной нуклеиновой кислоты, содержащей трансген, кодирующий CAR, при этом молекула нуклеиновой кислоты содержит нуклеотидную последовательность, кодирующую анти-CD19 связывающий домен, выбранную из одной или более из SEQ ID NOS: 61-72, при этом последовательность граничит с, и находится в одной рамке считывания с нуклеотидной последовательностью, кодирующей внутриклеточный сигнальный домен. Иллюстративный внутриклеточный сигнальный домен, который можно использовать в CAR, включает, но не ограничивается ими, один или более внутриклеточных сигнальных доменов, например, CD3-дзета, CD28, 4-1BB и тому подобное. В некоторых случаях CAR может содержать любое сочетание из CD3-дзета, CD28, 4-1BB и тому подобного. В одном аспекте нуклеотидная последовательность конструкции CAR по изобретению выбрана из одной или более из SEQ ID NOS: 85-96. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 85. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 86. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 87. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 88. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 89. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 90. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 91. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 92. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 93. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 94. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 95. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 96. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 97. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 98. В одном аспекте нуклеотидная последовательность конструкции CAR представляет собой SEQ ID NO: 99.

Нуклеотидные последовательности, кодирующие нужные молекулы, можно получать с использованием рекомбинантных методов, известных в данной области, таких как, например, скрининг библиотек из клеток, экспрессирующих ген, извлечение гена из вектора, который, как известно, содержит его, или выделение непосредственно из клеток и тканей, содержащих ген, с использованием стандартных методик. Альтернативно, интересующую нуклеиновую кислоту можно получать синтетическими методами, а не клонированием.

Настоящее изобретение включает ретровирусные и лентивирусные векторные конструкции, экспрессирующие CAR, которые можно непосредственно трансдуцировать в клетку.

Настоящее изобретение также включает конструкцию РНК, которую можно непосредственно трансфицировать в клетку. Метод получения мРНК для использования в трансфекции включает in vitro транскрипцию (IVT) матрицы со специально разработанными праймерами, с последующим добавлением полиA для получения конструкции, содержащей 3' и 5'-нетранслируемую последовательность («UTR»), 5'-кэп и/или внутренний участок связывания рибосомы (IRES), нуклеиновую кислоту, которая должна быть экспрессирована, и полиA последовательность, как правило, длиной 50-2000 оснований (SEQ ID NO: 118). Полученная таким образом РНК может эффективно трансфицировать различные типы клеток. В одном варианте осуществления матрица включает последовательности для CAR. В одном варианте осуществления вектор РНК CAR трансдуцируют в T-клетку методом электропорации.

Антигенсвязывающий домен

В одном аспекте CAR по изобретению содержит специфичный в отношении мишени связывающий элемент, иначе называемый антигенсвязывающим доменом. Выбор фрагмента зависит от типа и числа лигандов, которые определяют поверхность клетки-мишени. Например, антигенсвязывающий домен может быть выбран для узнавания лиганда, который действует как маркер клеточной поверхности на клетка-мишенях, ассоциированный с конкретным болезненным состоянием. Так, примеры маркеров клеточной поверхности, которые могут действовать как лиганды для антигенсвязывающего домена в CAR по изобретению, включают маркеры, ассоциированные с вирусными, бактериальными и паразитарными инфекциями, аутоиммунными заболеваниями и раковыми клетками.

В одном аспекте опосредованный CAR T-клеточный ответ может быть направлен на интересующий антиген за счет конструирования антигенсвязывающего домена, который специфически связывает желаемый антиген с CAR.

В одном аспекте часть CAR, содержащая антигенсвязывающий домен, содержит антигенсвязывающий домен, направленный на CD19. В одном аспекте антигенсвязывающий домен направлен на CD19 человека. В одном аспекте антигенсвязывающий домен CAR имеет такую же или сходную специфичность связывания, что и фрагмент FMC63 scFv, описанный в статье Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997).

Антигенсвязывающий домен может быть любым доменом, который связывается с антигеном, включая, но не ограничиваясь ими, моноклональное антитело, поликлональное антитело, рекомбинантное антитело, человеческое антитело, гуманизированное антитело, а также его функциональный фрагмент, включая, но не ограничиваясь ими, однодоменное антитело, такое как вариабельный домен тяжелой цепи (VH), вариабельный домен легкой цепи (VL) и вариабельный домен (VHH) нанотела, производного от антител верблюдовых, а также альтернативный каркас, известный в данной области, который действует как антигенсвязывающий домен, например, рекомбинантный домен фибронектина, и тому подобное. В некоторых случаях полезно, если антигенсвязывающий домен происходит из организма того же вида, для которого в конечном итоге будет использован CAR. Например, в случае использования для человека, может быть полезным, если антигенсвязывающий домен CAR будет содержать человеческие или гуманизированные остатки в антигенсвязывающем домене антитела или фрагмента антитела.

Таким образом, в одном аспекте антигенсвязывающий домен содержит гуманизированное антитело или фрагмент антитела. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 легкой цепи (LC CDR1), определяющей комплементарность области 2 легкой цепи (LC CDR2) и определяющей комплементарность области 3 легкой цепи (LC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, и/или одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированного анти-CD19 связывающего домена, содержащего одну или более, например, все три, LC CDR и одну или более, например, все три, HC CDR. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит одну или более (например, все три) из определяющей комплементарность области 1 тяжелой цепи (HC CDR1), определяющей комплементарность области 2 тяжелой цепи (HC CDR2) и определяющей комплементарность области 3 тяжелой цепи (HC CDR3) гуманизированного анти-CD19 связывающего домена, описанного в настоящем документе, например, гуманизированный анти-CD19 связывающий домен имеет две вариабельные области тяжелой цепи, каждая из которых содержит HC CDR1, HC CDR2 и HC CDR3, описанные в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область легкой цепи, описанную в настоящем документе (например, в таблице 3), и/или гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3). В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит гуманизированную вариабельную область тяжелой цепи, описанную в настоящем документе (например, в таблице 3), например, по меньшей мере две гуманизированные вариабельные области тяжелой цепи, описанные в настоящем документе (например, в таблице 3). В одном варианте осуществления анти-CD19 связывающий домен представляет собой scFv, содержащий легкую цепь и тяжелую цепь с аминокислотной последовательностью, приведенной в таблице 3. В одном варианте осуществления анти-CD19 связывающий домен (например, scFv) содержит: вариабельную область легкой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области легкой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3; и/или вариабельную область тяжелой цепи, содержащую аминокислотную последовательность, имеющую по меньшей мере одну, две или три модификации (например, замены), но не более чем 30, 20 или 10 модификаций (например, замен), аминокислотной последовательности вариабельной области тяжелой цепи, приведенной в таблице 3, или последовательность, имеющую 95-99% идентичности с аминокислотной последовательностью в таблице 3. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, SEQ ID NO: 4, SEQ ID NO: 5, SEQ ID NO: 6, SEQ ID NO: 7, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, SEQ ID NO: 11 и SEQ ID NO: 12, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления последовательность нуклеиновой кислоты, кодирующая гуманизированный анти-CD19 связывающий домен, содержит последовательность, выбранную из группы, состоящей из SEQ ID NO: 61, SEQ ID NO: 62, SEQ ID NO: 63, SEQ ID NO: 64, SEQ ID NO: 65, SEQ ID NO: 66, SEQ ID NO: 67, SEQ ID NO: 68, SEQ ID NO: 70, SEQ ID NO: 71 и SEQ ID NO: 72, или последовательность, имеющую 95-99% идентичности с ними. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен представляет собой scFv, и вариабельная область легкой цепи, содержащая аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, присоединена к вариабельной области тяжелой цепи, содержащей аминокислотную последовательность, описанную в настоящем документе, например, в таблице 3, через линкер, например, линкер, описанный в настоящем документе. В одном варианте осуществления гуманизированный анти-CD19 связывающий домен содержит линкер (Gly4-Ser)n, где n равно 1, 2, 3, 4, 5 или 6, предпочтительно 3 или 4 (SEQ ID NO: 53). Вариабельная область легкой цепи и вариабельная область тяжелой цепи в scFv могут находиться, например, в любой из следующих ориентаций: вариабельная область легкой цепи-линкер-вариабельная область тяжелой цепи или вариабельная область тяжелой цепи-линкер-вариабельная область легкой цепи.

В одном аспекте область антигенсвязывающего домена содержит одну или более последовательностей, выбранных из SEQ ID NOS: 1-12. В одном аспекте гуманизированный CAR выбирают из одной или более последовательностей, выбранных из SEQ ID NOS: 31-42. В некоторых аспектах антитело, отличное от человеческого, является гуманизированным, при этом определенные последовательности или области антитела модифицированы для увеличения сходства с антителом, естественным образом продуцируемым в организме человека, или его фрагментом. В одном аспекте антигенсвязывающий домен является гуманизированным.

Гуманизированное антитело можно получать с использованием различных методов, известных в данной области, включая, но не ограничиваясь ими, трансплантацию CDR (смотри, например, Европейский патент № EP 239400, международную патентную публикацию № WO 91/09967 и патенты США №№ 5225539, 5530101 и 5585089, полное содержание каждого из которых включено в настоящий документ посредством ссылки), облицовку или изменение поверхности (смотри, например, Европейские патенты №№ EP 592106 и EP 519596, Padlan, 1991, Molecular Immunology, 28(4/5): 489-498; Studnicka et al., 1994, Protein Engineering, 7(6): 805-814; и Roguska et al., 1994, PNAS, 91: 969-973, полное содержание каждого из которых включено в настоящий документ посредством ссылки), перетасовку цепей (смотри, например, патент США № 5565332, полное содержание которого включено в настоящий документ посредством ссылки), а также способы, раскрытые, например, в публикации патентной заявки США № US 2005/0042664, публикации патентной заявки США US 2005/0048617, патенте США № 6407213, патенте США № 5766886, международной патентной публикации № WO 9317105, Tan et al., J. Immunol., 169: 1119-25 (2002), Caldas et al., Protein Eng., 13(5): 353-60 (2000), Morea et al., Methods, 20(3): 267-79 (2000), Baca et al., J. Biol. Chem., 272(16): 10678-84 (1997), Roguska et al., Protein Eng., 9(10): 895-904 (1996), Couto et al., Cancer Res., 55 (23 Supp): 5973s-5977s (1995), Couto et al., Cancer Res., 55(8): 1717-22 (1995), Sandhu J.S., Gene, 150(2): 409-10 (1994) и Pedersen et al., J. Mol. Biol., 235(3): 959-73 (1994), полное содержание которых включено в настоящий документ посредством ссылки. Часто каркасные остатки в каркасных областях будут заменены соответствующим остатком из антитела-донора CDR для изменения, например, улучшения, связывания антигена. Эти замены в каркасе определяют методами, хорошо известными в данной области, например, путем моделирования взаимодействий CDR и каркасных остатков для идентификации каркасных остатков, важных для связывания антигена, и сравнения последовательностей для идентификации необычных каркасных остатков в конкретных положениях. (Смотри, например, Queen et al., патент США № 5585089 и Riechmann et al., 1988, Nature, 332: 323, полное содержание которых включено в настоящий документ посредством ссылки).

Гуманизированное антитело или фрагмент антитела имеет один или более аминокислотных остатков, оставшихся в нем из источника, отличного от человека. Эти не принадлежащие человеку аминокислотные остатки часто называют «импортированными» остатками, которые, как правило, получены из «импортированного» вариабельного домена. Как описано в настоящем документе, гуманизированные антитела или фрагменты антител содержат одну или более CDR из молекул иммуноглобулина, отличного от человеческого, и каркасные области, в которых аминокислотные остатки, составляющие каркас, получены полностью или в основном из последовательностей зародышевой линии человека. Множество методов гуманизации антител или фрагментов антител хорошо известны в данной области, и гуманизацию, по существу, можно выполнять, следуя методу Winter и соавторов (Jones et al., Nature, 321: 522-525 (1986); Riechmann et al., Nature, 332: 323-327 (1988); Verhoeyen et al., Science, 239: 1534-1536 (1988)), заменяя CDR или последовательности CDR грызунов на соответствующие последовательности человеческого антитела, то есть, выполняя трансплантацию CDR (EP 239400, PCT публикация № WO 91/09967 и патенты США №№ 4816567, 6331415, 5225539, 5530101, 5585089, 6548640, полное содержание которых включено в настоящий документ посредством ссылки). В таких гуманизированных антителах и фрагментах антител, значительно меньше, чем интактный вариабельный домен человека, заменен соответствующей последовательностью из видов, отличных от человека. Гуманизированные антитела часто представляют собой человеческие антитела, в которых некоторые остатки CDR и возможно некоторые остатки каркаса (FR) заменены остатками из аналогичных участков в антителах грызунов. Гуманизацию антител и фрагментов антител также можно выполнять путем облицовки или изменения поверхности (EP 592106, EP 519596, Padlan, 1991, Molecular Immunology, 28(4/5): 489-498, Studnicka et al., Protein Engineering, 7(6): 805-814 (1994) и Roguska et al., PNAS, 91: 969-973 (1994)), или перетасовки цепей (патент США № 5565332), полное содержание которых включено в настоящий документ посредством ссылки.

Выбор человеческих вариабельных доменов, как легкой, так и тяжелой цепей, для использования в создании гуманизированных антител имеет целью снижение антигенности. В соответствии с так называемым методом «наилучшего соответствия» проводят скрининг последовательности вариабельного домена антитела грызунов против полной библиотеки известных последовательностей вариабельных доменов человека. Затем человеческие последовательности, которые ближе всего к последовательностям грызунов, выбирают в качестве человеческого каркаса (FR) для гуманизированного антитела (Sims et al., J. Immunol., 151: 2296 (1993), Chothia et al., J. Mol. Biol., 196: 901 (1987), полное содержание которых включено в настоящий документ посредством ссылки). В другом методе используют конкретный каркас, выведенный из консенсусной последовательности всех человеческих антител конкретной подгруппы легких или тяжелых цепей. Один и тот же каркас можно использовать для нескольких разных гуманизированных антител (смотри, например, Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997), Carter et al., Proc. Natl. Acad. Sci. USA, 89: 4285 (1992), Presta et al., J. Immunol., 151: 2623 (1993), полное содержание которых включено в настоящий документ посредством ссылки). В некоторых вариантах осуществления каркасная область, например, все четыре каркасные области вариабельной области тяжелой цепи происходят из последовательности зародышевой линии VH4_4-59. В одном варианте осуществления каркасная область может содержать одну, две, три, четыре или пять модификаций, например, замен, например, из аминокислоты в соответствующей мышиной последовательности (например, SEQ ID NO: 58). В одном варианте осуществления каркасная область, например, все четыре каркасные области вариабельной области легкой цепи происходят из последовательности зародышевой линии VK3_1,25. В одном варианте осуществления каркасная область может содержать одну, две, три, четыре или пять модификаций, например, замен, например, из аминокислоты в соответствующей мышиной последовательности (например, SEQ ID NO: 58).

В некоторых аспектах часть композиции CAR по изобретению, которая содержит фрагмент антитела, является гуманизированной с сохранением высокой аффинности в отношении целевого антигена и других полезных биологических свойств. В соответствии с одним аспектом изобретения, гуманизированные антитела и фрагменты антител получают методом анализа родительских последовательностей и различных концептуальных гуманизированных продуктов с использованием трехмерных моделей родительских и гуманизированных последовательностей. Трехмерные модели иммуноглобулинов обычно доступны и знакомы специалистам в данной области. Также доступны компьютерные программы, которые иллюстрируют и демонстрируют возможные трехмерные конформационные структуры выбранных последовательностей иммуноглобулинов-кандидатов. Изучение этих проекций позволяет анализировать вероятную роль остатков в функционировании последовательности иммуноглобулина-кандидата, например, анализировать остатки, которые влияют на способность иммуноглобулина-кандидата связывать целевой антиген. Таким образом, остатки FR можно выбирать и объединять с последовательностями реципиента и импортированными последовательностями так, что достигается желательная характеристика антитела или фрагмента антитела, например, повышенная аффинность в отношении целевого антигена. Как правило, остатки CDR непосредственно и в наиболее значительной степени оказывают влияние на связывание антигена.

Гуманизированное антитело или фрагмент антитела может сохранять такую же антигенную специфичность, что и исходное антитело, например, в настоящем изобретении способность связывать человеческий CD19. В некоторых вариантах осуществления гуманизированное антитело или фрагмент антитела может иметь улучшенную аффинность и/или специфичность связывания с человеческим CD19.

В одном аспекте анти-CD19 связывающий домен характеризуется конкретными функциональными особенностями или свойствами антитела или фрагмента антитела. Например, в одном аспекте часть композиции CAR по изобретению, которая содержит антигенсвязывающий домен, специфически связывает человеческий CD19. В одном аспекте антигенсвязывающий домен имеет такую же или аналогичную специфичность связывания с человеческим CD19, что и scFv FMC63, описанный в статье Nicholson et al. Mol. Immun. 34 (16-17): 1157-1165 (1997). В одном аспекте изобретение относится к антигенсвязывающему домену, содержащему антитело или фрагмент антитела, при этом связывающий домен антитела специфически связывается с белком CD19 или его фрагментом, причем антитело или фрагмент антитела содержит вариабельный домен легкой цепи и/или вариабельный домен тяжелой цепи, который содержит аминокислотную последовательность SEQ ID NO: 1-12. В одном аспекте антигенсвязывающий домен содержит аминокислотную последовательность scFv, выбранную из SEQ ID NOs: 1-12. В некоторых аспектах scFv граничит с, и находится в одной рамке считывания с лидерной последовательностью. В одном аспекте лидерная последовательность представляет собой полипептидную последовательность, приведенную в SEQ ID NO: 13.

В одном аспекте анти-CD19 связывающий домен представляет собой фрагмент, например, одноцепочечный вариабельный фрагмент (scFv). В одном аспекте анти-CD19 связывающий домен представляет собой Fv, Fab, (Fab')2 или бифункциональное (например, биспецифическое) гибридное антитело (например, Lanzavecchia et al., Eur. J. Immunol. 17, 105 (1987)). В одном аспекте антитела и их фрагменты по изобретению связывают белок CD19 с соответствующей дикому типу или улучшенной аффинностью.

В некоторых случаях scFv фрагменты можно получать методом, известным в данной области (смотри, например, Bird et al., (1988) Science 242: 423-426 и Huston et al., (1988) Proc. Natl. Acad. Sci. USA 85: 5879-5883). Молекулы scFv можно получать путем связывания вместе VH и VL областей с использованием гибких полипептидных линкеров. Молекулы scFv содержат линкер (например, Ser-Gly линкер) с оптимизированной длиной и/или аминокислотным составом. Длина линкера может сильно влиять на то, как вариабельные области scFv укладываются и взаимодействуют. Действительно, при использовании короткого полипептидного линкера (например, длиной 5-10 аминокислот) предотвращается внутрицепочечная укладка. Межцепочечная укладка также необходима для сведения вместе двух вариабельных областей для образования функционального эпитопсвязывающего сайта. Примеры ориентации и размеров линкера можно найти, например, в статье Hollinger et al. 1993 Proc Natl Acad. Sci. U.S.A. 90: 6444-6448, публикациях патентных заявок США №№ 2005/0100543, 2005/0175606, 2007/0014794 и PCT публикациях №№ WO 2006/020258 и WO 2007/024715, содержание которых включено в настоящий документ посредством ссылки.

ScFv может содержать линкер из по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45, 50 или более аминокислотных остатков между VL и VH областями. Последовательность линкера может содержать любую природную аминокислоту. В некоторых вариантах осуществления последовательность линкера содержит аминокислоты глицин и серин. В другом варианте осуществления последовательность линкера содержит группы повторов из глицина и серина, такие как (Gly4Ser)n, где n является положительным целым числом, равным или большим чем 1 (SEQ ID NO: 18). В одном варианте осуществления линкер может представлять собой (Gly4Ser)4 (SEQ ID NO: 106) или (Gly4Ser)3 (SEQ ID NO: 107). Вариации в длине линкера могут способствовать сохранению или усилению активности, что приводит к высокой эффективности в исследованиях активности.

Стабильность и мутации

Стабильность анти-CD19 связывающего домена, например, молекулы scFv (например, растворимого scFv), можно оценивать в сравнении с биофизическими свойствами (например, термической стабильностью) обычной контрольной молекулы scFv или полноразмерного антитела. В одном варианте осуществления гуманизированный scFv имеет термическую стабильность, которая превышает на примерно 0,1, примерно 0,25, примерно 0,5, примерно 0,75, примерно 1, примерно 1,25, примерно 1,5, примерно 1,75, примерно 2, примерно 2,5, примерно 3, примерно 3,5, примерно 4, примерно 4,5, примерно 5, примерно 5,5, примерно 6, примерно 6,5, примерно 7, примерно 7,5, примерно 8, примерно 8,5, примерно 9, примерно 9,5, примерно 10 градусов, примерно 11 градусов, примерно 12 градусов, примерно 13 градусов, примерно 14 градусов, или примерно 15 градусов Цельсия термическую стабильность контрольной связывающей молекулы (например, обычной молекулы scFv) в описанных анализах.

Повышенная термическая стабильность анти-CD19 связывающего домена, например, scFv, впоследствии передается целой конструкции CART19, что приводит к улучшению терапевтических свойств конструкции CART19. Термическая стабильность анти-CD19 связывающего домена, например, scFv, может быть повышена по меньшей мере примерно на 2°C или 3°C по сравнению с обычным антителом. В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, имеет повышенную на 1°C термическую стабильность по сравнению с обычным антителом. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, имеет повышенную на 2°C термическую стабильность по сравнению с обычным антителом. В другом варианте осуществления scFv имеет повышенную на 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15°C термическую стабильность по сравнению с обычным антителом. Сравнения можно проводить, например, между молекулами scFv, раскрытыми в настоящем документе, и молекулами scFv, или Fab-фрагментами антитела, из которого были получены VH и VL scFv. Термическую стабильность можно измерять методами, известными в данной области. Например, в одном варианте осуществления можно измерять Tm. Методы измерения Tm и другие методы определения стабильности белков описаны более подробно ниже.

Мутации в scFv (возникающие вследствие гуманизации или прямого мутагенеза растворимого scFv) изменяют стабильность scFv и повышают общую стабильность scFv и конструкции CART19. Стабильность гуманизированного scFv сравнивают со стабильностью мышиного scFv, используя такие показатели, как Tm, температура денатурации и температура агрегации.

Связывающую способность мутантных scFv можно определять с использованием анализов, описанных в примерах.

В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит по меньшей мере одну мутацию, возникающую в результате процесса гуманизации, так, что мутантный scFv придает повышенную стабильность конструкции CART19. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит по меньшей мере 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 мутаций, возникающих в результате процесса гуманизации, так, что мутантный scFv придает повышенную стабильность конструкции CART19.

Методы оценки стабильности белков

Стабильность антигенсвязывающего домена можно оценивать с использованием, например, методов, описанных ниже. Такие методы позволяют определять множественные температурные конформационные переходы с уничтожением складок, при которых наименее стабильный домен либо разворачивается в первую очередь, либо ограничивает общий порог стабильности мульдоменной единицы, которая разворачивается согласованно (например, мультидоменный белок, который демонстрирует один конформационный переход с уничтожением складок). Наименее стабильный домен можно определять с помощью целого ряда дополнительных методов. Можно проводить мутагенез для исследования того, который домен ограничивает общую стабильность. Кроме того, можно изучать устойчивость к протеазе мультидоменного белка в условиях, когда известно, что наименее стабильный домен будет действительно развернут, методами ДСК или другими спектроскопическими методами (Fontana, et al., (1997) Fold. Des., 2: R17-26; Dimasi et al. (2009) J. Mol. Biol. 393: 672-692). После того, как идентифицирован наименее стабильный домен, последовательность, кодирующую этот домен (или ее часть), можно использовать в качестве тестовой последовательности в методах.

a) Термическая стабильность

Термическую стабильность композиций можно анализировать с использованием ряда неограничивающих биофизических или биохимических методов, известных в данной области. В конкретных вариантах осуществления термическую стабильность оценивают методом аналитической спектроскопии.

Иллюстративным методом аналитической спектроскопии является дифференциальная сканирующая калориметрия (ДСК). В ДСК используют калориметр, который чувствителен к поглощению тепла, сопровождающему разворачивание большинства белков или доменов белков (смотри, например, Sanchez-Ruiz, et al., Biochemistry, 27: 1648-52, 1988). Для определения термической стабильности белка образец белка вставляют в калориметр и температуру повышают до тех пор, пока Fab или scFv не разворачивается. Температура, при которой белок разворачивается, является показателем общей стабильности белка.

Другим иллюстративным методом аналитической спектроскопии является спектроскопия кругового дихроизма (КД). Методом КД спектрометрии измеряют оптическую активность композиции в зависимости от повышения температуры. Методом спектроскопии кругового дихроизма (КД) измеряют разницу в поглощении левополяризованного света и правополяризованного света, которая возникает вследствие структурной асимметрии. Нарушенная или развернутая структура приводит к КД-спектрам, сильно отличающимся от спектра упорядоченной или свернутой структуры. КД-спектр отражает чувствительность белков к денатурирующему воздействию повышающейся температуры и, таким образом, является показателем термической стабильности белка (смотри van Mierlo and Steemsma, J. Biotechnol., 79(3): 281-98, 2000).

Другим иллюстративным методом аналитической спектроскопии для измерения термической стабильности является флуоресцентная эмиссионная спектроскопия (смотри van Mierlo and Steemsma, выше). Другим иллюстративным методом аналитической спектроскопии для измерения термической стабильности является спектроскопия ядерного магнитного резонанса (ЯМР) (смотри, например, van Mierlo and Steemsma, выше).

Термическую стабильность композиции можно измерять биохимическими методами. Иллюстративным биохимическим методом для оценки термической стабильности является анализ температурного воздействия. В «анализе температурного воздействия» композицию подвергают воздействию диапазона повышенных температур в течение заданного периода времени. Например, в одном варианте осуществления тестируемые молекулы scFv или молекулы, содержащие молекулы scFv, подвергают воздействию диапазона повышающихся температур, например, в течение 1-1,5 часов. Затем анализируют активность белка в соответствующем биохимическом анализе. Например, если белок представляет собой связывающий белок (например, scFv или scFv-содержащий полипептид), связывающую активность связывающего белка можно определять функциональным или количественным методом ELISA.

Такой анализ можно выполнять в высокопроизводительном формате и такие анализы с использованием E. coli и высокопроизводительного скрининга описаны в разделе «Примеры». Библиотеку анти-CD19 связывающих доменов, например, вариантов scFv, можно создавать с использованием методов, известных в данной области. Можно индуцировать экспрессию анти-CD19 связывающего домена, например, scFv, и анти-CD19 связывающий домен, например, scFv, можно подвергать воздействию повышенных температур. Подвергнутые воздействию тестовые образцы можно анализировать на связывание, и эти анти-CD19 связывающие домены, например, scFv, которые являются стабильными, можно нарабатывать в большом количестве и далее характеризовать.

Термическую стабильность оценивают путем измерения температуры плавления (Tm) композиции с использованием любого из вышеуказанных методов (например, методов аналитической спектроскопии). Температура плавления представляет собой температуру в средней точке кривой теплового перехода, в которой 50% молекул композиции находятся в свернутом состоянии (смотри, например, Dimasi et al. (2009) J. Mol Biol. 393: 672-692). В одном варианте осуществления значение Tm для анти-CD19 связывающего домена, например, scFv, составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значение Tm для IgG составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C. В одном варианте осуществления значение Tm для мультивалентного антитела составляет примерно 40°C, 41°C, 42°C, 43°C, 44°C, 45°C, 46°C, 47°C, 48°C, 49°C, 50°C, 51°C, 52°C, 53°C, 54°C, 55°C, 56°C, 57°C, 58°C, 59°C, 60°C, 61°C, 62°C, 63°C, 64°C, 65°C, 66°C, 67°C, 68°C, 69°C, 70°C, 71°C, 72°C, 73°C, 74°C, 75°C, 76°C, 77°C, 78°C, 79°C, 80°C, 81°C, 82°C, 83°C, 84°C, 85°C, 86°C, 87°C, 88°C, 89°C, 90°C, 91°C, 92°C, 93°C, 94°C, 95°C, 96°C, 97°C, 98°C, 99°C, 100°C.

Термическую стабильность также оценивают путем измерения удельной теплоемкости или теплоемкости (Cp) композиции с использованием метода аналитической калориметрии (например, ДСК). Удельная теплоемкость композиции представляет собой энергию (например, в ккал/моль), необходимую для повышения температуры 1 моля воды на 1°C. Высокое значение Cp является показателем денатурированной или неактивной белковой композиции. Изменение теплоемкости (ΔCp) композиции измеряют путем определения удельной теплоемкости композиции до и после ее теплового перехода. Термическую стабильность можно также оценивать путем измерения или определения других параметров термодинамической стабильности, включая свободную энергию Гиббса для разворачивания (ΔG), энтальпию разворачивания (ΔΗ) или энтропию разворачивания (ΔS). Один или более из вышеуказанных биохимических анализов (например, анализ температурного воздействия) используют для определения температуры (то есть, значения Tc), при которой 50% композиции сохраняет свою активность (например, связывающую активность).

Кроме того, мутации в анти-CD19 связывающем домене, например, scFv, приводят к изменению термической стабильности анти-CD19 связывающего домена, например, scFv, по сравнению с не мутантным анти-CD19 связывающим доменом, например, scFv. Когда гуманизированный анти-CD19 связывающий домен, например, scFv, включен в конструкцию CART19, анти-CD19 связывающий домен, например, гуманизированный scFv, придает термическую стабильность всей конструкции анти-CD19 CART. В одном варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит одну мутацию, которая придает термическую стабильность анти-CD19 связывающему домену, например, scFv. В другом варианте осуществления анти-CD19 связывающий домен, например, scFv, содержит несколько мутаций, которые придают термическую стабильность анти-CD19 связывающему домену, например, scFv. В одном варианте осуществления несколько мутаций в анти-CD19 связывающем домене, например, scFv, оказывают дополнительное влияние на термическую стабильность анти-CD19 связывающего домена, например, scFv.

b) % Агрегации

Стабильность композиции можно определять путем измерения ее тенденции к агрегации. Агрегацию можно измерять с помощью ряда неограничивающих биохимических или биофизических методов. Например, агрегацию композиции можно оценивать методом хроматографии, например, эксклюзионной хроматографии (ЭХ) (SEC). При ЭХ молекулы разделяются в зависимости от размеров. Колонка заполнена полутвердыми гранулами полимерного геля, внутрь которых проникают ионы и небольшие молекулы, но не крупные молекулы. Когда белковую композицию наносят сверху на колонку, плотно свернутые белки (то есть, не агрегированные белки) распределяются в большем объеме растворителя, чем возможно для крупных белковых агрегатов. Следовательно, крупные агрегаты быстрее проходят через колонку и, таким образом, смесь можно разделять или фракционировать на компоненты. Каждую фракцию можно отдельно количественно определять (например, при помощи рассеяния света), когда она элюируется с геля. Соответственно, % агрегации в композиции можно определять путем сравнения концентрации фракции с общей концентрацией белка, нанесенного на гель. Стабильные композиции элюируются с колонки в виде практически единственной фракции и выглядят как практически один пик на профиле элюции или хроматограмме.

c) Аффинность связывания

Стабильность композиции можно оценивать путем определения аффинности связывания мишени. Множество разных методов определения аффинности связывания известны в данной области. В иллюстративном методе определения аффинности связывания используют поверхностный плазмонный резонанс. Поверхностный плазмонный резонанс это оптическое явление, которое позволяет анализировать в режиме реального времени биоспецифические взаимодействия путем обнаружения изменений в концентрациях белка в биосенсорной матрице, например, с использованием системы BIAcore (Pharmacia Biosensor AB, Uppsala, Sweden и Piscataway, N.J.). Для более подробной информации смотри Jonsson, U., et al. (1993) Ann. Biol. Clin. 51: 19-26, Jonsson, U., et al. (1991) Biotechniques 11: 620-627, Johnsson, B., et al. (1995) J. Mol. Recognit. 8: 125-131 и Johnnson, B., et al. (1991) Anal. Biochem. 198: 268-277.

В одном аспекте антигенсвязывающий домен в CAR содержит аминокислотную последовательность, которая гомологична аминокислотной последовательности антигенсвязывающего домена, описанной в настоящем документе, и антигенсвязывающий домен сохраняет желательные функциональные свойства фрагментов анти-CD19 антитела, описанных в настоящем документе. В одном конкретном аспекте композиция CAR по изобретению содержит фрагмент антитела. В другом аспекте этот фрагмент антитела представляет собой scFv.

В различных аспектах антигенсвязывающий домен в CAR сконструирован путем модификации одной или более аминокислот в одной или обеих вариабельных областях (например, VH и/или VL), например, в одной или более областях CDR и/или в одной или более каркасных областях. В одном конкретном аспекте композиция CAR по изобретению содержит фрагмент антитела. В другом аспекте этот фрагмент антитела представляет собой scFv.

Любому специалисту в данной области будет понятно, что антитело или фрагмент антитела по изобретению можно дополнительно модифицировать таким образом, что они будут отличаться по аминокислотной последовательности (например, от дикого типа), но не по желательной активности. Например, можно осуществлять дополнительные нуклеотидные замены, ведущие к аминокислотным заменам в «несущественных» аминокислотных остатках в белке. Например, несущественный аминокислотный остаток в молекуле можно заменять другим аминокислотным остатком из того же семейства боковых цепей. В другом варианте осуществления последовательность аминокислот можно заменять структурно сходной последовательностью, которая отличается по порядку и/или составу членов семейства боковых цепей, например, можно выполнять консервативную замену, при которой аминокислотный остаток заменяют аминокислотным остатком, имеющим аналогичную боковую цепь.

Семейства аминокислотных остатков, имеющих аналогичные боковые цепи, известны в данной области, включая аминокислоты с основными боковыми цепями (например, лизин, аргинин, гистидин), кислотными боковыми цепями (например, аспарагиновая кислота, глутаминовая кислота), незаряженными полярными боковыми цепями (например, глицин, аспарагин, глутамин, серин, треонин, тирозин, цистеин), неполярными боковыми цепями (например, аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан), бета-разветвленными боковыми цепями (например, треонин, валин, изолейцин) и ароматическими боковыми цепями (например, тирозин, фенилаланин, триптофан, гистидин).

Процент идентичности в контексте двух или более нуклеотидных или полипептидных последовательностей определяют для двух или более последовательностей, которые являются одинаковыми. Две последовательности являются «в значительной степени идентичными», если две последовательности имеют определенный процент аминокислотных остатков или нуклеотидов, которые являются одинаковыми (например, 60% идентичности, необязательно, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности на протяжении определенной области или, если не указано конкретно, на протяжении всей последовательности), при сравнении и выравнивании для максимального соответствия в окне сравнения, или определенной области, что количественно определяют с использованием одного из следующих алгоритмов сравнения последовательностей или при выравнивании вручную и визуальном осмотре. Необязательно, идентичность существует на протяжении области, имеющей в длину по меньшей мере примерно 50 нуклеотидов (или 10 аминокислот), или более предпочтительно, на протяжении области, имеющей в длину от 100 до 500 или 1000, или более нуклеотидов (или 20, 50, 200 или более аминокислот).

Для сравнения последовательностей, как правило, одну последовательность принимают за эталонную последовательность, с которой сравнивают тестируемую последовательность. При использовании алгоритма сравнения последовательностей тестируемую и эталонную последовательности вводят в компьютер, задают координаты подпоследовательностей, если необходимо, и задают параметры программы для сравнения последовательностей. Можно использовать параметры по умолчанию программы или задавать альтернативные параметры. Алгоритм сравнения последовательностей затем рассчитывает процент идентичности последовательностей для тестируемых последовательностей относительно эталонной последовательности, на основании параметров программы. Способы выравнивания последовательностей для сравнения хорошо известны в данной области. Оптимальное выравнивание последовательностей для сравнения можно проводить, например, с помощью алгоритма локальной гомологии Смита-Уотермана, (1970) Adv. Appl. Math. 2:482c, алгоритма глобального выравнивания Нидлмана-Вунша, (1970) J. Mol. Biol. 48: 443, методом поиска сходства Пирсона-Липмана, (1988) Proc. Nat'l. Acad. Sci. USA 85: 2444, с помощью компьютерных реализаций этих алгоритмов (GAP, BESTFIT, FASTA и TFASTA в пакете программ Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI) или с использованием выравнивания вручную и визуального осмотра (смотри, например, Brent et al., (2003) Current Protocols in Molecular Biology).

Двумя примерами алгоритмов, которые подходят для определения процентной идентичности последовательностей и сходства последовательностей, являются алгоритмы BLAST и BLAST 2.0, которые описаны в Altschul et al., (1977) Nuc. Acids Res. 25: 3389-3402 и Altschul et al., (1990) J. Mol. Biol. 215: 403-410, соответственно. Программное обеспечение для выполнения анализов BLAST является общедоступным через Национальный центр биотехнологической информации.

Процент идентичности между двумя аминокислотными последовательностями можно также определять с использованием алгоритма, описанного в статье E. Meyers and W. Miller, (1988) Comput. Appl. Biosci. 4: 11-17, который включен в программу ALIGN (версия 2.0), с использованием таблицы весов замен остатков PAM120, штрафа на продолжение делеции 12 и штрафа на внесение делеции 4. Кроме того, процент идентичности между двумя аминокислотными последовательностями можно определять с использованием алгоритма Нидлмана-Вунша (1970) J. Mol. Biol. 48: 444-453), который включен в программу GAP в пакете программ GCG (доступно на сайте www.gcg.com), с использованием либо матрицы Blossom 62, либо матрицы PAM250, и штрафом на внесение делеции 16, 14, 12, 10, 8, 6 или 4 и штрафом на продолжение делеции 1, 2, 3, 4, 5 или 6.

В одном аспекте настоящего изобретения предусмотрены модификации исходной аминокислотной последовательности антитела или фрагмента (например, scFv), при которых получают функционально эквивалентные молекулы. Например, VH или VL анти-CD19 связывающего домена, например, scFv, содержащиеся в CAR, могут быть модифицированы, с сохранением по меньшей мере примерно 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности с исходной каркасной областью VH или VL анти-CD19 связывающего домена, например, scFv. По настоящему изобретению предусмотрены модификации во всей конструкции CAR, например, модификации в одной или более аминокислотных последовательностях разных доменов конструкции CAR, для получения функционально эквивалентных молекул. Конструкция CAR может быть модифицирована с сохранением по меньшей мере примерно 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% идентичности с исходной конструкцией CAR.

Трансмембранный домен

Что касается трансмембранного домена, в различных вариантах осуществления может быть сконструирован CAR, который содержит трансмембранный домен, присоединенный к внеклеточному домену CAR. Трансмембранный домен может содержать одну или более дополнительных аминокислот, прилегающих к трансмембранной области, например, одну или более аминокислот, связанных с внеклеточной областью белка, из которого получен трансмембранная область (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, вплоть до 15 аминокислот из внеклеточной области), и/или одну или более дополнительных аминокислот, связанных с внутриклеточной областью белка, из которого получен трансмембранный белок (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, вплоть до 15 аминокислот из внутриклеточной области). В одном аспекте используют трансмембранный домен, который представляет собой домен, связанный с одним из других доменов CAR. В некоторых случаях трансмембранный домен можно выбирать или модифицировать путем аминокислотной замены, чтобы избежать связывания таких доменов с трансмембранными доменами тех же или других поверхностных мембранных белков, например, чтобы свести к минимуму взаимодействия с другими членами рецепторного комплекса. В одном аспекте трансмембранный домен способен к гомодимеризации с другим CAR на поверхности CART-клетки. В другом аспекте аминокислотную последовательность трансмембранного домена можно модифицировать или заменять с тем, чтобы свести к минимуму взаимодействия со связывающими доменами естественного партнера по связыванию, присутствующего в той же самой CART.

Трансмембранный домен можно получать либо из природного, либо из рекомбинантного источника. Если источник является природным, домен можно получать из любого связанного с мембраной или трансмембранного белка. В одном аспекте трансмембранный домен способен передавать сигнал внутриклеточному домену(ам) после того, как CAR связался с мишенью. Трансмембранный домен, особенно полезный для данного изобретения, может содержать по меньшей мере трансмембранную область(и) из, например, альфа, бета или дзета-цепи T-клеточного рецептора, CD28, CD3-эпсилон, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154.

В некоторых случаях трансмембранный домен может быть присоединен к внеклеточной области CAR, например, антигенсвязывающему домену CAR, через шарнир, например, шарнир из человеческого белка. Например, в одном варианте осуществления шарнир может представлять собой шарнир из Ig (иммуноглобулина) человека, например, шарнир IgG4 или шарнир CD8a. В одном варианте осуществления шарнир или спейсер содержит (например, состоит из) аминокислотную последовательность SEQ ID NO: 14. В одном аспекте трансмембранный домен содержит (например, состоит из) трансмембранный домен SEQ ID NO: 15.

В одном аспекте шарнир или спейсер представляет собой шарнир IgG4. Например, в одном варианте осуществления шарнир или спейсер представляет собой шарнир с аминокислотной последовательностью

ESKYGPPCPPCPAPEFLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSQEDPEVQFNWYVDGVEVHNAKTKPREEQFNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKGLPSSIEKTISKAKGQPREPQVYTLPPSQEEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSRLTVDKSRWQEGNVFSCSVMHEALHNHYTQKSLSLSLGKM (SEQ ID NO: 45).

В некоторых вариантах осуществления шарнир или спейсер представляет собой шарнир, кодируемый нуклеотидной последовательностью

GAGAGCAAGTACGGCCCTCCCTGCCCCCCTTGCCCTGCCCCCGAGTTCCTGGGCGGACCCAGCGTGTTCCTGTTCCCCCCCAAGCCCAAGGACACCCTGATGATCAGCCGGACCCCCGAGGTGACCTGTGTGGTGGTGGACGTGTCCCAGGAGGACCCCGAGGTCCAGTTCAACTGGTACGTGGACGGCGTGGAGGTGCACAACGCCAAGACCAAGCCCCGGGAGGAGCAGTTCAATAGCACCTACCGGGTGGTGTCCGTGCTGACCGTGCTGCACCAGGACTGGCTGAACGGCAAGGAATACAAGTGTAAGGTGTCCAACAAGGGCCTGCCCAGCAGCATCGAGAAAACCATCAGCAAGGCCAAGGGCCAGCCTCGGGAGCCCCAGGTGTACACCCTGCCCCCTAGCCAAGAGGAGATGACCAAGAACCAGGTGTCCCTGACCTGCCTGGTGAAGGGCTTCTACCCCAGCGACATCGCCGTGGAGTGGGAGAGCAACGGCCAGCCCGAGAACAACTACAAGACCACCCCCCCTGTGCTGGACAGCGACGGCAGCTTCTTCCTGTACAGCCGGCTGACCGTGGACAAGAGCCGGTGGCAGGAGGGCAACGTCTTTAGCTGCTCCGTGATGCACGAGGCCCTGCACAACCACTACACCCAGAAGAGCCTGAGCCTGTCCCTGGGCAAGATG (SEQ ID NO: 46).

В одном аспекте шарнир или спейсер представляет собой шарнир IgD. Например, в одном варианте осуществления шарнир или спейсер представляет собой шарнир с аминокислотной последовательностью

RWPESPKAQASSVPTAQPQAEGSLAKATTAPATTRNTGRGGEEKKKEKEKEEQEERETKTPECPSHTQPLGVYLLTPAVQDLWLRDKATFTCFVVGSDLKDAHLTWEVAGKVPTGGVEEGLLERHSNGSQSQHSRLTLPRSLWNAGTSVTCTLNHPSLPPQRLMALREPAAQAPVKLSLNLLASSDPPEAASWLLCEVSGFSPPNILLMWLEDQREVNTSGFAPARPPPQPGSTTFWAWSVLRVPAPPSPQPATYTCVVSHEDSRTLLNASRSLEVSYVTDH (SEQ ID NO: 47).

В некоторых вариантах осуществления шарнир или спейсер представляет собой шарнир, кодируемый нуклеотидной последовательностью

AGGTGGCCCGAAAGTCCCAAGGCCCAGGCATCTAGTGTTCCTACTGCACAGCCCCAGGCAGAAGGCAGCCTAGCCAAAGCTACTACTGCACCTGCCACTACGCGCAATACTGGCCGTGGCGGGGAGGAGAAGAAAAAGGAGAAAGAGAAAGAAGAACAGGAAGAGAGGGAGACCAAGACCCCTGAATGTCCATCCCATACCCAGCCGCTGGGCGTCTATCTCTTGACTCCCGCAGTACAGGACTTGTGGCTTAGAGATAAGGCCACCTTTACATGTTTCGTCGTGGGCTCTGACCTGAAGGATGCCCATTTGACTTGGGAGGTTGCCGGAAAGGTACCCACAGGGGGGGTTGAGGAAGGGTTGCTGGAGCGCCATTCCAATGGCTCTCAGAGCCAGCACTCAAGACTCACCCTTCCGAGATCCCTGTGGAACGCCGGGACCTCTGTCACATGTACTCTAAATCATCCTAGCCTGCCCCCACAGCGTCTGATGGCCCTTAGAGAGCCAGCCGCCCAGGCACCAGTTAAGCTTAGCCTGAATCTGCTCGCCAGTAGTGATCCCCCAGAGGCCGCCAGCTGGCTCTTATGCGAAGTGTCCGGCTTTAGCCCGCCCAACATCTTGCTCATGTGGCTGGAGGACCAGCGAGAAGTGAACACCAGCGGCTTCGCTCCAGCCCGGCCCCCACCCCAGCCGGGTTCTACCACATTCTGGGCCTGGAGTGTCTTAAGGGTCCCAGCACCACCTAGCCCCCAGCCAGCCACATACACCTGTGTTGTGTCCCATGAAGATAGCAGGACCCTGCTAAATGCTTCTAGGAGTCTGGAGGTTTCCTACGTGACTGACCATT (SEQ ID NO: 48).

В одном аспекте трансмембранный домен может быть рекомбинантным, в этом случае он будет содержать преимущественно гидрофобные остатки, такие как лейцин и валин. В одном аспекте триплет из фенилаланина, триптофана и валина может присутствовать на каждом конце рекомбинантного трансмембранного домена.

Необязательно, короткий олиго- или полипептидный линкер, длиной от 2 до 10 аминокислот может быть связующим звеном между трансмембранным доменом и цитоплазматической областью CAR. Дуплет глицин-серин является особенно подходящим линкером. Например, в одном аспекте линкер содержит аминокислотную последовательность GGGGSGGGGS (SEQ ID NO: 49). В некоторых вариантах осуществления линкер кодируется нуклеотидной последовательностью GGTGGCGGAGGTTCTGGAGGTGGAGGTTCC (SEQ ID NO: 50).

Цитоплазматический домен

Цитоплазматический домен или область CAR включает внутриклеточный сигнальный домен. Внутриклеточный сигнальный домен, как правило, отвечает за активацию по меньшей мере одной из нормальных эффекторных функций иммунной клетки, в которую введен CAR. Термин «эффекторная функция» означает специализированную функцию клетки. Эффекторной функцией T-клетки, например, может быть цитолитическая активность или хелперная активность, включая секрецию цитокинов. Таким образом, термин «внутриклеточный сигнальный домен» означает часть белка, которая передает сигнал эффекторной функции и направляет клетку на выполнение специализированной функции. Хотя, как правило, можно использовать целый внутриклеточный сигнальный домен, во многих случаях нет необходимости в использовании всей цепи. В случае использования укороченной части внутриклеточного сигнального домена, такую укороченную часть можн