24.07.2020
220.018.377f

АНТИГЕНЫ И АНТИГЕННЫЕ КОМПОЗИЦИИ

Вид РИД

Изобретение

Юридическая информация Свернуть Развернуть
№ охранного документа
0002727476
Дата охранного документа
21.07.2020
Краткое описание РИД Свернуть Развернуть
Аннотация: Изобретение относится к биотехнологии и представляет собой иммуногенную композицию, содержащую выделенный или рекомбинантный полипептидный антиген нетипируемого штамма H. influenzae NTHI1292 (NT067) и один или более фармацевтически приемлемых носителей, разбавителей и/или адъювантов, для применения в способе индукции защитного иммунного ответа против инфекции H. influenzae у млекопитающего, причем указанный антиген NT067 представляет собой полипептид, включающий аминокислотную последовательность SEQ ID NO: 5 или SEQ ID NO: 52. Изобретение касается также способа профилактики или лечения инфекций, вызываемых нетипируемым штаммом H. influenzae, который включает стадию введения млекопитающему эффективного количества описанной выше композиции. 3 н. и 15 з.п. ф-лы, 5 табл.
Реферат Свернуть Развернуть

По этой заявке испрашивается приоритет временной заявки на патент Великобритании № 1207385.4, поданной 26 апреля 2012 г., и заявки на европейский патент № ЕР12199079.0, поданной 21 декабря 2012 г., которые полностью включены в настоящее описание изобретения в качестве ссылки в соответствии со всеми целями изобретения.

Область техники, к которой относится изобретение

Настоящее изобретение относится к области иммунологии и вакцинологии Haemophilus influenzae, в частности, нетипируемых штаммов H. influenzae (NTHI). Настоящее изобретение относится к антигенным полипептидам и комбинациям антигенных полипептидов, предназначенным для образования антител и возбуждения иммунных реакций против штаммов H. influenzae. Настоящее изобретение также относится к композициям, содержащим такие антигены, и их применению в качестве вакцин или лекарственных средств против H. influenzae. Настоящее изобретение также относится к иммуногенным композициям, содержащим такие антигены, которые могут быть использованы отдельно или в комбинации либо вместе с другими вакцинами. Настоящее изобретение также относится к способам возбуждения иммунных реакций против H. influenzae и способам лечения или профилактики инфекций, вызываемых H. influenzae.

Уровень техники

Haemophilus influenzae представляет собой мелкую, неподвижную, грамотрицательную коккобактерию. Указанная коккобактерия является патогенным микроорганизмом дыхательных путей, вызывающим широкий спектр инфекций у человека, в том числе: бессимптомное образование колоний микроорганизмов в верхних дыхательных путях (то есть носительство бактерий); инфекции, обусловленные микроорганизмами, колонизирующими слизистые поверхности, которые вызывают отит (воспаление среднего уха), бронхит, конъюнктивит, синусит, инфекции мочевых путей и пневмонию; и инвазивные инфекции, такие как бактериемия, септический артрит, эпиглоттит, пневмония, эмпиема, перикардит, целлюлит, остеомиелит и менингит. H. influenzae была первой бактерией, для которой была опубликована полная геномная последовательность [1].

Штаммы H. influenzae являются капсулированными (типируемыми) или некапсулированными (нетипируемыми), при этом имеется шесть основных серологических типов капсулированных штаммов (а-f). 95% инвазивных заболеваний, обусловленных H. influenzae, вызывают штаммы H. influenzae типа b (‘Hib’). Самым серьезным заболеванием, вызываемым Hib, является менингит, но создание в 1980-х годах вакцин на основе сахаридов, конъюгированных с капсульным Hib, существенно сократило число случаев заболевания менингитом.

Несмотря на то, что в настоящее время с инфекциями, вызываемыми Hib, можно бороться вакцинацией, другие патогенные штаммы H. influenzae по-прежнему являются опасными. Например, нетипируемый штамм H. influenzae (NTHI) вызывает отит (ОМ), в частности, хронический и острый отит. Отит, который редко является причиной смерти, характеризуется высокой степенью заболеваемости. Наиболее распространенным осложнением отита является глухота, которая сопровождается задержками поведенческого, образовательного и речевого развития при возникновении отита в раннем возрасте. Острый отит является самой распространенной бактериальной инфекцией у детей в США. Нетипируемый штамм H. influenzae египетской биогруппы вызывает эпидемический конъюнктивит и бразильскую пурпуру (BPF) [2], при которой смертность достигает 70%.

В настоящее время антибиотики являются главным средством борьбы с широким спектром клинических патогенных микроорганизмов, известных как ОМ, но негативным результатом широкого применения антибиотиков для лечения отита стало появление микроорганизмов, устойчивых к многим антибиотикам. Процесс создания вакцины замедлен из-за недостаточного понимания патогенеза отита и иммунной реакции на указанное заболевание.

Геномная последовательность штамма KW20 серотипа d [1,3] имеет важное значение для понимания основополагающей биологии H. influenzae, но не является такой же полезной для противодействия патогенным штаммам H. influenzae, так как штаммы серотипа d обычно не являются патогенными микроорганизмами. Полипептиды из патогенных нетипируемых штаммов H. influenzae были идентифицированы и исследованы в качестве вакцин-кандидатов. В ссылке 4 описаны иммуногенные полипептиды, выделенные из патогенного нетипируемого штамма H. influenzae.

Однако по-прежнему существует потребность в вакцине, способной защитить от широкого спектра штаммов Haemophilus influenzae. H. influenzae является микроорганизмом, способным размножаться в различных тканях, адаптироваться к новым нишам и вызывать широкий спектр заболеваний. Факторы приспособляемости, вирулентности и колонизации могут изменяться, позволяя указанному микроорганизму адаптироваться к разным тканям и хозяевам. Поэтому потенциальные антигены подвергаюся сильному селективному давлению, в результате чего в разных штаммах может иметь место вариабельность последовательностей.

Таким образом, сохраняется потребность в идентификации новых и улучшенных антигенов, предназначенных для использования в вакцинах против нетипируемых штаммов Haemophilus influenzae и, в частности, в вакцинах, пригодных для борьбы с многочисленными патологиями, вызываемыми NTHI.

База данных геномов на сайте ncbi.nlm.nih.gov в разделе геномов патогенных и непатогенных штаммов Haemophilus influenzae включает от 2500 до 4000 белков. Однако в данном списке не указаны белки, которые являются консервативными для значительной части патогенных NTHI, а также области, которые являются консервативными в указанных белках, и белки среди тысяч потенциальных белков, которые могут быть использованы в вакцине для возбуждения иммунной реакции, достаточной для защиты от патогенных штаммов NTHI, что требует скрининга большого числа белков для идентификации лучших кандидатов.

Объектом настоящего изобретения являются новые и лучшие антигены и/или комбинации, позволяющие эффективно вызывать иммунные реакции против разных штаммов H. influenzae, которые могут быть использованы при создании вакцин для профилактики и/или лечения инфекций, вызываемых патогенными микроорганизмами H. influenzae, в частности, нетипируемыми штаммами H. influenzae. Объектом настоящего изобретения являются полипептиды и комбинации полипептидов, предназначенные для использования в усовершенствованных иммуногенных композициях и вакцинах для профилактики и/или лечения таких инфекций, в частности, острого отита и хронического обструктивного заболевания легких (COPD). Указанные полипептиды могут быть также пригодны для диагностических целей и в качестве мишеней для антибиотиков.

Описание изобретения

Настоящее изобретение относится к полипептидам нетипируемых штаммов Haemophilus influenzae (NTHI), пригодным для иммунизации как отдельно, так и в комбинации. Указанные полипептиды могут быть объединены с другими полипептидами NTHI. Указанные антигены предназначены для использования в вакцинах против NTHI, но могут быть также использованы в качестве компонентов в вакцинах для иммунизации против многочисленных патогенных микроорганизмов.

Благодаря применению двух параллельных методов, а именно обратной вакцинологии и протеомного анализа пузырьков наружной мембраны (OMV), стало возможным идентифицировать антигены, которые являются консервативными в 86 разных штаммах NTHI. В обратной вакцинологии использован анализ in silico для идентификации белков, являющихся консервативными в геномах разных штаммов NTHI и потенциально экспонированных на поверхности. Второй метод наоборот сфокусирован на идентификации антигенов при помощи масс-спектрометрического анализа белков, присутствующих в пузырьках наружной мембраны, продуцированных NTHI.

Геном штамма NTHI включает примерно 1800 генов. Авторы настоящего изобретения идентифицировали 274 консервативных антигена в 15 полных геномах и 39 штаммах, выбранных на основе географического распределения, и 32 штаммах, выделенных из финской коллекции отита, которые в настоящее время являются общедоступными. Из указанных 274 антигенов авторы настоящего изобретения выбрали 53 полипептида, представляющих определенный интерес. Указанные антигены были выбраны из штамма NP86-028 за исключением антигена CGSHiGG_00130, выбранного из штамма PittG, CGSHiGG_02400, выбранного из штамма PittG, gi-145633184, выбранного из штамма 3655, и gi-145628236, выбранного из штамма 22.1-21.

Из группы, состоящей из 53 антигенов, был произведен дальнейший отбор с учетом критериев иммуногенности и консерватизма:

- набор из 26 антигенов, определяемый в настоящем описании изобретения как ”первая группа антигенов”;

- набор из 6 антигенов, определяемый в настоящем описании изобретения как ”вторая группа антигенов”;

- набор из 21 антигена, определяемый в настоящем описании изобретения как ”третья группа антигенов”.

Наиболее предпочтительным набором антигенов по настоящему изобретению является ”первая группа антигенов”. Таким образом, изобретение относится к иммуногенной композиции, включающей по меньшей мере один антиген, предпочтительно один или несколько (то есть 1, 2, 3, 4, 5, 6 или больше) антигенов, выбираемых из группы, состоящей из: (1) NTHI0915 (NT018), (2) NTHI1416 (NT024), (3) NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038), (5) NTHI1292 (NT067), (6) NTHI0877 (NT001), (7) NTHI0266 (NT016), (8) CGSHiGG_00130 (NT052), (9) NTHI1627 (NT002), (10) NTHI1109 (NT026), (11) NTHI0821 (NT009), (12) NTHI0409 (NT025), (13) NTHI1954 (NT028), (14) NTHI0371 (NT029), (15) NTHI0509 (NT031), (16) NTHI0449 (NT015), (17) NTHI1473 (NT023), (18) gi-145633184 (NT100), (19) NTHI1110 (NT040), (20) gi-46129075 (NT048), (21) gi-145628236 (NT053), (22) NTHI1230 (NT066), (23) NTHI0522 (NT097), (24) NT004, (25) NT014, (26) NT022. Указанные антигены обладают положительной бактериальной активностью, как показано в таблице III и таблице IV.

В первой группе антигенов предпочтительные антигены выбраны из подгруппы, включающей (1) антиген NTHI0915 (NT018), (2) антиген NTHI1416 (NT024), (3) антиген NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038), (5) антиген NTHI1292 (NT067), (6) антиген NTHI0877 (NT001), (8) антиген NT052, (24) антиген NT004, (25) антиген NT014, (26) антиген NT022, (7) антиген NTHI0266 NT016. Указанные антигены характеризуются высокой степенью очистки, как показано в таблице II, и иммуногенной эффективностью, как показано в таблицах III и IV.

Особенно предпочтительными антигенами были NT067, NT014, NT016, NT022.

Таким образом, настоящее изобретение относится к иммуногенной композиции, включающей один или несколько (то есть 1, 2, 3, 4, 5, 6 или больше) антигенов, выбираемых из группы, состоящей из ”первой группы антигенов”.

Также были идентифицированы 6 следующих полипептидов: (24) Р48 (NTHI0254, также определяемый как NT007), (25) HtrA (NTHI1905, также определяемый как NT006), (26) PE (NTHI0267, также определяемый как NT035), (27) Р26 (NTHI0501, также определяемый как NT010), (28) PHiD (NTHI0811, также определяемый как NT080), (29) Р6 (NTHI0501, также определяемый как NT081). Указанный набор из 6 антигенов определяется в настоящем описании изобретения как ”вторая группа антигенов”.

Также были идентифицированы 22 следующих полипептида: (30) NTHI0532 (NT013), (31) NTHI0363 (NT106), (32) NTHI0370 (NT107), (33) NTHI0205 (NT108), (34) NTHI0374 (NT109), (35) NTHI0579 (NT110), (36) NTHI0837 (NT111), (37) NTHI0849 (NT112), (38) NTHI0921 (NT113), (39) NTHI0995 (NT114), (40) NTHI1091 (NT115), (41) NTHI1169 (NT116), (42) NTHI1208 (NT117), (43) NTHI1318 (NT118), (44) NTHI1796 (NT123), (45) NTHI1930 (NT124), (46) NTHI1565 (NT119), (47) NTHI1569 (NT120), (48) NTHI1571 (NT121), (49) NTHI1667 (NT122), (50) NTHI0588 (NT061), (51) NTHI0915 (NT017). Указанный набор из 22 антигенов определяется в настоящем описании изобретения как ”третья группа антигенов”.

В одном варианте осуществления изобретения композиция включает по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из первой группы антигенов, и/или по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из второй группы антигенов, и/или по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из третьей группы антигенов. Антигены из первой группы антигенов могут быть выбраны из наиболее предпочтительной подгруппы антигенов.

Настоящее изобретение предпочтительно относится к иммуногенной композиции, включающей один антиген, выбираемый из первой группы антигенов, второй группы антигенов или третьей группы антигенов.

Таким образом, настоящее изобретение также относится к иммуногенной композиции, содержащей комбинацию антигенов, которая включает два или больше (то есть 2, 3, 4, 5, 6 или больше) антигенов, выбираемых из группы, состоящей из ”первой группы антигенов”, ”второй группы антигенов” и/или ”третьей группы антигенов”.

Когда композиция включает антиген из ”второй группы антигенов”, желательно, чтобы указанная композиция также включала (i) по меньшей мере еще один антиген из ”второй группы антигенов” или (ii) по меньшей мере один антиген из ”первой группы антигенов” или “третьей группы антигенов”. Таким образом, в объем настоящего изобретения не входит композиция, включающая в качестве единственного антигенного компонента один антиген из ”второй группы антигенов”. Когда композиция включает два или больше антигенов из ”второй группы антигенов”, желательно, чтобы композиция включала по меньшей мере один антиген, который не является (а) антигеном Р48, (b) антигеном HtrA, (c) антигеном РЕ или (d) антигеном Р26. Таким образом, некоторые варианты осуществления изобретения не относятся к комбинациям, включающим только антигены Р48, HtrA, PE и/или Р26. Аналогичным образом некоторые варианты осуществления изобретения не относятся к гибридным антигенам, включающим 'X' части, состоящие только из антигенов Р48, HtrA, PE и/или Р26.

11 предпочтительных антигенов из первой группы антигенов образуют 55 возможных пар разных антигенов. Все такие пары рассмотрены в настоящем описании изобретения и являются частью изобретения. Таким образом, настоящее изобретение относится к иммуногенной композиции, включающей одну пару антигенов, при этом данная пара является одной из 55 указанных пар.

В одном варианте осуществления изобретения композиция включает по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из первой группы антигенов, и/или по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из второй группы антигенов, и/или по меньшей мере один антиген (то есть 1, 2, 3, 4, 5, 6 или больше), выбираемый из третьей группы антигенов.

Во всех случаях антигены из первой группы антигенов могут быть выбраны из наиболее предпочтительной подгруппы антигенов, состоящей из (1) NTHI0915 (NT018), (2) NTHI1416 (NT024), (3) NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038), (5) NTHI1292 (NT067), (6) NTHI0877 (NT001), (8) NT052, (24) NT004, (25) NT014, (26) NT022, (7) NT016.

Настоящее изобретение также относится к иммуногенной композиции, содержащей комбинацию антигенов, которая включает два или больше (то есть 2, 3, 4 или 5) антигенов, выбираемых из группы, состоящей из: (1) NTHI0915 (NT018), (2) NTHI1416 (NT024), (3) NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038), (5) NTHI1292 (NT067), (6) NTHI0877 (NT001), (8) NT052, (24) NT004, (25) NT014, (26) NT022, (7) NT016. Указанная композиция может также содержать адъювант, например, адъювант, включающий эмульсию масла в воде или соль алюминия.

В ссылке 5 рассмотрены антигены нетипируемого штамма H. influenzae наряду с прочими кандидатами для возможного использования в вакцинах. В ссылках 6-10 представлены полипептиды Р48, HtrA, PE и Р26 нетипируемого штамма H. influenzae и охарактеризован их иммуногенный потенциал. В ссылке 5 также указаны полипептиды HtrA, PE и Р26 среди большого числа кандидатов для использования в вакцинах, и ссылка 10 относится к полипептиду РЕ. Однако в приведенных публикациях не было рассмотрено использование указанных антигенов, относящихся ко ”второй группе антигенов”, в комбинации. Как установлено в настоящее время, комбинация одного или нескольких указанных антигенов (из второй группы антигенов) по меньшей мере с одним антигеном из ”первой группы антигенов” является особенно полезной для возбуждения защитной иммунной реакции против нетипируемого штамма H. influenzae, и, таким образом, является объектом настоящего изобретения.

Предпочтительными комбинациями по настоящему изобретению являются такие комбинации, в которых два или больше антигенов действуют синергически. Таким образом, защита от патогенного микроорганизма NTHI, достигаемая при объединенном введении указанных антигенов, превышает защиту, ожидаемую в результате простого сложения защитной эффективности каждого из указанных антигенов.

Первая группа антигенов

Антиген NT018

Антиген ”NT018” аннотирован как белок, содержащий повтор TPR, а также как гемолизная субъединица созревания цитохрома CcmH2. Данный антиген был аннотирован как NTHI0915 в штамме 86-028NP. Указанная последовательность является высококонсервативной во всех анализированных штаммах и предположительно представляет собой мембраносвязанную металлопептидазу. Антиген NT018 экспонирован на поверхности, как показано в таблице III. Антиген NT018 был клонирован и экспрессирован в другом нетипируемом штамме Fi176, который является штаммом, полученным из финской коллекции отита.

Приемлемые антигены NT018 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:1, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:1; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:1, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT018 включают варианты SEQ ID NO:1, такие как SEQ ID NO:49, которая была клонирована, экспрессирована и испытана в отношении иммуногенности (таблица III, IV). Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:1. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 26, 27, 28 или больше) в положении N-конца SEQ ID NO:1 при сохранении по меньшей мере одного эпитопа SEQ ID NO:1. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT018 по настоящему изобретению может быть экспрессирован с 28 нативными N-концевыми аминокислотами NT018 (MNFTLIFILTTLVVALICFYPLLRQFKA; SEQ ID NO:69) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT024

Антиген ”NT024” аннотирован как ”гипотетический белок” и был аннотирован как NTHI1416 в геноме 86-028NP. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT024 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:2, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:2; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:2, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT024 включают варианты SEQ ID NO:2, такие как SEQ ID NO:50, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:2. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:2 при сохранении по меньшей мере одного эпитопа SEQ ID NO:2. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT024 по настоящему изобретению может быть экспрессирован с 20 нативными N-концевыми аминокислотами NT024 (MKLKLFFHIVLLCFSLPVWA; SEQ ID NO:70) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT032

Антиген ”NT032” аннотирован как ”гипотетический белок” и был аннотирован как NTHI2017 в геноме 86-028NP. Наиболее консервативный домен в исследованных штаммах описан как ”бактериальный ОВ-складчатый (BOF) белок”. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT032 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:3, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:3; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:3, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT032 включают варианты SEQ ID NO:3, такие как SEQ ID NO:51, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:3. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:3 при сохранении по меньшей мере одного эпитопа SEQ ID NO:3. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT032 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами NT032 (MKKFALATIFALATTSAFA; SEQ ID NO:71) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT067

Антиген ”NT067” аннотирован как белок-транспортер АВС, и его гипотетическая функция была определена в качестве периплазматического олигопептид-связывающего белка ОррА. Антиген NT0676 был аннотирован как NTHI1292 в штамме 86-028NP. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT067 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:5, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:5; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:5, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT067 включают варианты SEQ ID NO:5, такие как SEQ ID NO:52, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:5. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:5 при сохранении по меньшей мере одного эпитопа SEQ ID NO:5. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT067 по настоящему изобретению может быть экспрессирован с 20 нативными N-концевыми аминокислотами NT067 (MQHKLLFSAIALALSYSVQA; SEQ ID NO:72) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT038

Указанный антиген, известный как белок Hia (адгезин Haemophilus influenzae) [11], был идентифицирован в штамме CGSHiGG_02400 как белок, состоящий из 282 аминокислот, однако, указанный белок является усеченной формой белка Hia (616 аминокислот), который был первоначально описан в штамме 86-028NP и в других штаммах NTHi. Указанный антиген был клонирован в штамме R2846.

Приемлемые антигены NT038 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:4, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:4; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:4, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT038 включают варианты SEQ ID NO:4, такие как SEQ ID NO:53, в которой отсутствуют первые 23 нативные N-концевые аминокислоты и 102 аминокислоты в положении С-конца. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:4. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца (даже до 102 аминокислот) и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 23, 25 или больше) в положении N-конца SEQ ID NO:4 при сохранении по меньшей мере одного эпитопа SEQ ID NO:4. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT038 по настоящему изобретению может быть экспрессирован с 23 нативными N-концевыми аминокислотами NT038 (MPFQYVTEDGKTVVKVGNGYYEA; SEQ ID NO:73) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT001

Указанный антиген был аннотирован как NTHI0877 в геноме 86-028NP и известен как D-метионин-связывающий липопротеин MetQ. MetD является транспортером АВС, кодирующим систему поглощения DL метионина. Данный антиген ранее был описан как BASB202 (28 кДа) [12, 13] и предложен для использования в качестве вакцины против NTHI. Указанный антиген на 99,63% идентичен гомологичному антигену, описанному в ссылке (4) и, как установлено, является высококонсервативным во всех штаммах, рассмотренных в настоящем описании изобретения. В настоящем изобретении указанный антиген клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT001 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:6, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:6; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:6, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT001 включают варианты SEQ ID NO:4, такие как SEQ ID NO:54. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:6. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 21, 25 или больше) в положении N-конца SEQ ID NO:6 при сохранении по меньшей мере одного эпитопа SEQ ID NO:6. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT001 по настоящему изобретению может быть экспрессирован с 21 нативной N-концевой аминокислотой NT001 (MKLKQLFAITAIASALVLTGC; SEQ ID NO:74) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT016

Указанный антиген был аннотирован как NTHI0266 в штамме 86-028NP и описан в качестве гипотетического липопротеина. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT016 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:7, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:7; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:7, где 'n' равно 7 или более (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или более). Указанные белки NT016 включают варианты SEQ ID NO:7, такие как SEQ ID NO:55. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:7. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:7 при сохранении по меньшей мере одного эпитопа SEQ ID NO:7. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT016 по настоящему изобретению может быть экспрессирован с 16 нативными N-концевыми аминокислотами NT016 (MRKIKSLALLAVAALVIGC; SEQ ID NO:75) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT052

Указанный антиген был аннотирован как CGSHiGG_00130 в штамме PittGG. Данный антиген является частью семейства белков, содержащих домен Sel1. Указанный антиген был клонирован в штамме R2846, и клонированная последовательность представлена как SEQ ID NO:8. Несмотря на то, что последовательность, клонированная в штамме R2846, только на 64,16% идентична последовательности, аннотированной как CGSHiGG_00130, было установлено, что данная последовательность содержит повторяющиеся консервативные домены Sel1, обладающие эффективными антигенными свойствами. Консенсусной последовательностью для указанных повторов является SEQ ID NO: EAVKWYRKAAEQ.

Приемлемые антигены NT052 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:8, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:8; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:8, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT052 включают варианты SEQ ID NO:8, такие как SEQ ID NO:56. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:8. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:8 при сохранении по меньшей мере одного эпитопа SEQ ID NO:8. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT052 по настоящему изобретению может быть экспрессирован с 11 нативными N-концевыми аминокислотами NT052 (MLLFILSIAWA; SEQ ID NO:76) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT002

Указанный антиген был аннотирован как NTHI1627 в штамме 86-026NP и как липопротеин. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT002 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:9, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:9; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:9, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT002 включают варианты SEQ ID NO:9, такие как SEQ ID NO:57. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:9. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:9 при сохранении по меньшей мере одного эпитопа SEQ ID NO:9. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT002 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT002 (MKVYKSFLIATASLFLFA; SEQ ID NO:77) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT026

Указанный антиген был аннотирован как гипотетический белок NTHI1109 в штамме 86-026NP. Данный антиген, согласно прогнозу, является цитоплазматическим мембранным белком. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT026 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:10, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:10; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:10, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT026 включают варианты SEQ ID NO:10, такие как SEQ ID NO:58, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:10. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:10 при сохранении по меньшей мере одного эпитопа SEQ ID NO:10. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT026 по настоящему изобретению может быть экспрессирован с 24 нативными N-концевыми аминокислотами NT026 (MQKGMTLVELLIGLAIISIVLNFA; SEQ ID NO:78) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT009

Указанный антиген был аннотирован как NTHI0821 в штамме 86-026NP и является частью семейства белков ОМР85. Данный антиген локализован в наружной мембране бактерий. Указанный антиген клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT009 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:11, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:11; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:11, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT009 включают варианты SEQ ID NO:11, такие как SEQ ID NO:59, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:11. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 22, 25 или больше) в положении N-конца SEQ ID NO:11 при сохранении по меньшей мере одного эпитопа SEQ ID NO:11. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT009 по настоящему изобретению может быть экспрессирован с 22 нативными N-концевыми аминокислотами NT009 (MNKTLLKLTALFLALNCFPAFA; SEQ ID NO:79) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT025

Указанный антиген был аннотирован как NTHI0409 в штамме 86-026NP и относится к семейству белков с субъединицей пилина IV типа. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT025 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:12, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:12; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:12, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT025 включают варианты SEQ ID NO:12, такие как SEQ ID NO:60, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:12. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 23, 25 или больше) в положении N-конца SEQ ID NO:12 при сохранении по меньшей мере одного эпитопа SEQ ID NO:12. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT025 по настоящему изобретению может быть экспрессирован с 23 нативными N-концевыми аминокислотами NT025 (MKLTTQQTLKKGFTLIELMIVIA; SEQ ID NO:80) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT028

Указанный антиген был аннотирован как NTHI1954 в штамме 86-026NP и как липопротеин NlpC. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT028 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:13, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:13; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:13, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT028 включают варианты SEQ ID NO:13, такие как SEQ ID NO:61, клонированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:13. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:13 при сохранении по меньшей мере одного эпитопа SEQ ID NO:13. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT028 по настоящему изобретению может быть экспрессирован с 21 нативной N-концевой аминокислотой NT028 (MLKRILVIIGLAVLATACSNA; SEQ ID NO:81) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT028 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT029

Указанный антиген был аннотирован как NTHI0371 в штамме 86-026NP и как гем/гемопексин-связывающий белок А, относящийся к семейству белков наружной мембраны. Данный антиген был клонирован и экспрессирован в штамме R2846.

Приемлемые антигены NT029 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:14, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:14; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:14, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT029 включают варианты SEQ ID NO:14, такие как SEQ ID NO:62, клонированная в штамме R2846. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:14. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:14 при сохранении по меньшей мере одного эпитопа SEQ ID NO:14. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT029 по настоящему изобретению может быть экспрессирован с 21 нативной N-концевой аминокислотой NT029 (MYKLNVISLIILTTYTGATYA; SEQ ID NO:82) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT031

Указанный антиген был аннотирован как индуцибельный липопротеин наружной мембраны клеток, выращенных на минимальной среде, NTHI0509 в штамме 86-026NP. Данный антиген был клонирован и экспрессирован в штамме R2846.

Приемлемые антигены NT031 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:15, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:15; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:15, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT031 включают варианты SEQ ID NO:15, такие как SEQ ID NO:63, клонированная и экспрессированная в штамме R2846. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:15. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 18, 20, 25 или больше) в положении N-конца SEQ ID NO:15 при сохранении по меньшей мере одного эпитопа SEQ ID NO:15. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT031 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT031 (MKGKITLFFTALCFGLTG; SEQ ID NO:83) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT031 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT015

Указанный антиген был аннотирован как ассоциированный с помутнением белок ОарВ NTHI0449 в штамме 86-026NP. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT015 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:16, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:16; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:16, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT015 включают варианты SEQ ID NO:16, такие как SEQ ID NO:64, клонированная и экспрессированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:16. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:16 при сохранении по меньшей мере одного эпитопа SEQ ID NO:16. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT015 по настоящему изобретению может быть экспрессирован с 17 нативными N-концевыми аминокислотами NT015 (MLKKTSLIFTALLLAGC; SEQ ID NO:84) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT023

Указанный антиген был аннотирован как липопротеин наружной мембраны РСР, NTHI1473 в штамме 86-026NP. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT023 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:17, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:17; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:17, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT023 включают варианты SEQ ID NO:17, такие как SEQ ID NO:65, клонированная и экспрессированная в штамме Fi176. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:17. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:17 при сохранении по меньшей мере одного эпитопа SEQ ID NO:17. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT023 по настоящему изобретению может быть экспрессирован с 20 нативными N-концевыми аминокислотами NT023 (MKKTNMALALLVAFSVTGCA; SEQ ID NO:85) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT023 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT100

Указанный антиген был аннотирован как ”предполагаемый рецептор железосодержащего сидерофора типа гидроксамата” и по классификации NCBI как gi-145633184 в штамме 3655. Данный антиген был клонирован в штамме R246.

Приемлемые антигены NT100 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:18, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:18; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:18, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT100 включают варианты SEQ ID NO:18, такие как SEQ ID NO:66. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:18. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:18 при сохранении по меньшей мере одного эпитопа SEQ ID NO:18. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT100 по настоящему изобретению может быть экспрессирован с 30 нативными N-концевыми аминокислотами NT100 (MDLGPIYNTRDINDGKVINIDNPNYTNPVA; SEQ ID NO:86) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT040

Указанный антиген был аннотирован как гипотетический белок NTHI1110 в штамме 86-026NP. Данный антиген был клонирован и экспрессирован в штамме R2846.

Приемлемые антигены NT040 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:19, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:19; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:19, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT040 включают варианты SEQ ID NO:19. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:19. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:19 при сохранении по меньшей мере одного эпитопа SEQ ID NO:19. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT040 по настоящему изобретению может быть экспрессирован с 26 нативными N-концевыми аминокислотами NT040 (MMKTLLKGQTLLALMISLTLSSLLLL; SEQ ID NO:87) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT048

Указанный антиген был аннотирован как NTHI1169 в штамме 86-028NP. Данный антиген был клонирован и экспрессирован в штамме R2846.

Приемлемые антигены NT048 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:20, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:20; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:20, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT048 включают варианты SEQ ID NO:20. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:20. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:20 при сохранении по меньшей мере одного эпитопа SEQ ID NO:20. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT048 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT048 (MKSVPLITGGLSFLLSAC; SEQ ID NO:88) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT053

Указанный антиген был аннотирован как gi-145628236 в штамме R2846 и клонирован в указанном штамме.

Приемлемые антигены NT053 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:21, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:21; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:21, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT053 включают варианты SEQ ID NO:21. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:21. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:21 при сохранении по меньшей мере одного эпитопа SEQ ID NO:21. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT053 по настоящему изобретению может быть экспрессирован с нативным N-концевым Met NT053 или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT066

Указанный антиген был аннотирован как NTHI1230 в штамме NP86-028 и локализован в периплазме бактерий. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT066 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:22, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:22; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:22, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT066 включают варианты SEQ ID NO:22, такие как SEQ ID NO:67. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:22. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 27, 30, 33 или больше) в положении N-конца SEQ ID NO:22 при сохранении по меньшей мере одного эпитопа SEQ ID NO:22. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT066 по настоящему изобретению может быть экспрессирован с 33 нативными N-концевыми аминокислотами NT066 (MKIYLRFVWILIIILNFLLNLFITTNGVIIVNA; SEQ ID NO:90) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT097

Указанный антиген был аннотирован как NTHI0522 в штамме NP86-028 и описан как белок-транспортер, подобный длинноцепочной жирной кислоте FadL, присутствующий, согласно прогнозу, в среде наружной мембраны. Данный антиген был клонирован и экспрессирован в штамме R2846.

Приемлемые антигены NT097 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:23, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:23; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:23, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT097 включают варианты SEQ ID NO:23. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:23. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 22, 25 или больше) в положении N-конца SEQ ID NO:23 при сохранении по меньшей мере одного эпитопа SEQ ID NO:23. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT097 по настоящему изобретению может быть экспрессирован с 22 нативными N-концевыми аминокислотами NT097 (MKKFNQSILATAMLLAAGGANA; SEQ ID NO:91) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT004

Указанный антиген был аннотирован как гипотетический белок CGSHiGG_08215 штамма PittGG в среде наружной мембраны. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT004 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:122, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:122; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:122, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT004 включают варианты SEQ ID NO:122. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:122. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 22, 25 или больше) в положении N-конца SEQ ID NO:122 при сохранении по меньшей мере одного эпитопа SEQ ID NO:122. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT004 по настоящему изобретению может быть экспрессирован с 20 нативными N-концевыми аминокислотами NT004 (MKKKNQILVSLSIVALLGGC; SEQ ID NO:125) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT014

Указанный антиген был аннотирован как гипотетический белок HI1658 в штамме Rd KW20. Данный антиген был клонирован и экспрессирован в штамме Fi176.

Приемлемые антигены NT014 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:123, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:123; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:123, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT014 включают варианты SEQ ID NO:123. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:123. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 22, 25 или больше) в положении N-конца SEQ ID NO:123 при сохранении по меньшей мере одного эпитопа SEQ ID NO:123. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT014 по настоящему изобретению может быть экспрессирован с 22 нативными N-концевыми аминокислотами NT014 (MTLSPLKKLAILLGATIFLQGC; SEQ ID NO:126) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT022

Указанный антиген был аннотирован как NTHI0830 в штамме NP96-028 и идентифицирован в качестве возможного антигенного липопротеина В наружной мембраны. Указанный антиген был клонирован и экспрессирован в штамме Fi176. Было также обнаружено, что указанный антиген содержит каталитический домен LytM, экспонирован на поверхности и секретирован.

Приемлемые антигены NT022 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:124, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:124; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:124, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT022 включают варианты SEQ ID NO:124. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:124. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 22, 25 или больше) в положении N-конца SEQ ID NO:124 при сохранении по меньшей мере одного эпитопа SEQ ID NO:124. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT022 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT022 (MKKSFLLLPLSLVVLSAC; SEQ ID NO:127) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Вторая группа антигенов

Антиген Р48

Полипептид Р48 был аннотирован в научной литературе как Na(+)-перемещающая субъединица А NADH-хинонредуктазы. Непроцессированная аминокислотная последовательность Р48 представлена в настоящем описании изобретения для справки как SEQ ID NO:24.

Предпочтительные полипептиды Р48, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:24, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:24, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды Р48 включают варианты SEQ ID NO:24. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:24. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:24 при сохранении по меньшей мере одного эпитопа SEQ ID NO:24. В других фрагментах отсутствует один или несколько доменов белка.

Антиген Р48 по настоящему изобретению в идеальном варианте не содержит 25 нативных N-концевых аминокислот Р48 (MITIKKGLDLPIAGKPAQVIHSGNA; SEQ ID NO:92) и поэтому должен быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

В соответствии с настоящим изобретением антиген Р48 может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами HtrA, PE, P26, PHiD и/или Р6, в частности, например, с антигеном HtrA.

Антиген HtrA

Полипептид HtrA был аннотирован в научной литературе как do/HhoA-подобный предшественник периплазматической сериновой протеазы и описан как хитшоковый белок или белок-компаньон. Непроцессированная аминокислотная последовательность HtrA представлена в настоящем описании изобретения для справки как SEQ ID NO:25.

Предпочтительные полипептиды HtrA, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:25, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:25, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды HtrA включают варианты SEQ ID NO:25. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:25. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:25 при сохранении по меньшей мере одного эпитопа SEQ ID NO:25. В других фрагментах отсутствует один или несколько доменов белка.

Антиген HtrA по настоящему изобретению в идеальном варианте не содержит 26 нативных N-концевых аминокислот HtrA (MKKTRFVLNSIALGLSVLSTSFVAQA; SEQ ID NO:93) и поэтому должен быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

В соответствии с настоящим изобретением антиген HtrA может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами P48, PE, P26, Р6 и/или PHiD, в частности, например, с антигеном P48.

Антиген РЕ

Полипептиид РЕ был аннотирован как белок, связывающий липопротеин - витронектин, или как связывающий IgD и действующий в качестве адгезина для альвеолярных клеток 2-го типа. Непроцессированная аминокислотная последовательность РЕ представлена в настоящем описании изобретения для справки как SEQ ID NO:26.

Предпочтительные полипептиды РЕ, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:26, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:24, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды РЕ включают варианты SEQ ID NO:26. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:26. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:26 при сохранении по меньшей мере одного эпитопа SEQ ID NO:26. В других фрагментах отсутствует один или несколько доменов белка.

Антиген РЕ по настоящему изобретению в идеальном варианте не содержит 16 нативных N-концевых аминокислот РЕ (MKKIILTLSLGLLTAC; SEQ ID NO:94) и поэтому должен быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

В соответствии с настоящим изобретением антиген РЕ может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами Р48, HtrA, P26, P6 и/или PHiD по настоящему изобретению.

Антиген Р26

Полипептид Р26 известен также как белок наружной мембраны 26. Указанный полипептид был аннотирован как член семейства белков Skp, предполагаемой функцией которых является транслокация белков наружной мембраны [5]. Непроцессированная аминокислотная последовательность Р26 представлена в настоящем описании изобретения для справки как SEQ ID NO:27.

Предпочтительные полипептиды Р26, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:27, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:27, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды Р26 включают варианты SEQ ID NO:27. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:27. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:27 при сохранении по меньшей мере одного эпитопа SEQ ID NO:27. В других фрагментах отсутствует один или несколько доменов белка.

В соответствии с настоящим изобретением антиген Р26 может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами Р48, HtrA, PE, PHiD и/или Р6 по настоящему изобретению, в частности, с любым или всеми антигенами Р48, HtrA и/или РЕ.

Антиген PHiD

Антиген PHiD, известный также как ”протеин D”, был использован главным образом в качестве белка-носителя в гликоконъюгатной вакцине против NTHI [95]. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Предпочтительные полипептиды PHiD, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:28, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:28, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды PHiD включают варианты SEQ ID NO:28. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:28. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:28 при сохранении по меньшей мере одного эпитопа SEQ ID NO:28. В других фрагментах отсутствует один или несколько доменов белка.

Антиген PhiD по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами PhiD (MKLKTLALSLLAAGVLAG; SEQ ID NO:95) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

В соответствии с настоящим изобретением антиген PHiD может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами Р48, HtrA, PE, P26 и/или Р6 по настоящему изобретению.

Антиген PhiD по настоящему изобретенмию может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген Р6

Антиген Р6 известен также как белок наружной мембраны 6 (ОМР 6) [14]. Указанный антиген был клонирован и экспрессирован в штамме Fi176.

Предпочтительные полипептиды Р6, предназначенные для использования в настоящем изобретении, включают аминокислотную последовательность, которая: (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:29, например, идентична на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:29, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150 или больше; например, 20 или больше; например, 50 или больше; например, 80 или больше). Указанные полипептиды Р6 включают варианты SEQ ID NO:29. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:29. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:29 при сохранении по меньшей мере одного эпитопа SEQ ID NO:29. В других фрагментах отсутствует один или несколько доменов белка.

Антиген P6 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами P6 (MNKFVKSLLVAGSVAALAA; SEQ ID NO:96) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

В соответствии с настоящим изобретением антиген P6 может быть успешно объединен с одним или несколькими (например, 1, 2 или 3) антигенами Р48, HtrA, PE, P26 и/или PHiD по настоящему изобретению.

Антиген P6 по настоящему изобретенмию может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Третья группа антигенов

Антиген NT013

Антиген ”NT013” аннотирован как белок, содержащий повтор TPR, а также как гемолиазная субъединица созревания цитохрома CcmH2. Данный антиген был выделен в виде NTHI0532 в штамме 86-028NP. NT013 был аннотирован как антиген, относящийся к семейству белков металлопротеазы и содержащий каталитический домен LytM.

Приемлемые антигены NT013 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:30, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:30; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:30, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT013 включают варианты SEQ ID NO:30. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:30. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:30 при сохранении по меньшей мере одного эпитопа SEQ ID NO:30. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT013 по настоящему изобретению может быть экспрессирован с 42 нативными N-концевыми аминокислотами NT013 (MPVQHVKLARDRRKKRTYIKVGVFFVAILLILTGILLTIKDK; SEQ ID NO:97) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT106

Антиген ”NT106”, аннотированный как липопротеин, был выделен в виде NTHI0363 в геноме 86-028NP.

Приемлемые антигены NT106 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:31, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:31; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:31, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT106 включают варианты SEQ ID NO:31. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:31. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:31 при сохранении по меньшей мере одного эпитопа SEQ ID NO:31. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT106 по настоящему изобретению может быть экспрессирован с 17 нативными N-концевыми аминокислотами NT106 (MKKIILNLVTAIILAGC; SEQ ID NO:98) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT106 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT107

Антиген “NT107”, аннотированный как ”гем/гемопексин-связывающий белок В”, выделен в виде NTHI0370 в геноме 86-028NP.

Приемлемые антигены NT107 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:32, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:32; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:32, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT107 включают варианты SEQ ID NO:32. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:32. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:32 при сохранении по меньшей мере одного эпитопа SEQ ID NO:32. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT107 по настоящему изобретению может быть экспрессирован с 28 нативными N-концевыми аминокислотами NT107 (MKMRPRYSVIASAVSLGFVLSKSVMALG; SEQ ID NO:99) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT108

Антиген ”NT108” аннотирован как липопротеин трансгликозилазы А муреина. Указанный антиген был аннотирован как NTHI0205 в штамме 86-028NP.

Приемлемые антигены NT108 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:33, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:33; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:33, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT108 включают варианты SEQ ID NO:33. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:33. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:33 при сохранении по меньшей мере одного эпитопа SEQ ID NO:33. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT108 по настоящему изобретению может быть экспрессирован с 24 нативными N-концевыми аминокислотами NT108 (MSVCKPFWFKTFSISIITALLVSC; SEQ ID NO:100) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT108 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT109

Указанный антиген, аннотированный как белок рецептора нитрата/нитрита NarQand, был идентифицирован как NTHI0374 в штамме 86-028NP, при этом было установлено, что данный антиген является консервативным во всех исследованных штаммах.

Приемлемые антигены NT109 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:34, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:34; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:34, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT109 включают варианты SEQ ID NO:34. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:34. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:34 при сохранении по меньшей мере одного эпитопа SEQ ID NO:34. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT109 по настоящему изобретению может быть экспрессирован с 33 нативными N-концевыми аминокислотами NT109 (MYTKGSVSTRIAKYLFIILIVAGVISSLSLAIM; SEQ ID NO:101) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT110

Указанный антиген, аннотированный как NTHI0579 в геноме 86-028NP, известен как предполагаемый гемолизин TlyC. Установлено, что данный антиген ассоциирован с наружной мембраной.

Приемлемые антигены NT110 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:35.

Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:35. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:35 при сохранении по меньшей мере одного эпитопа SEQ ID NO:35. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT110 по настоящему изобретению может быть экспрессирован с 30 нативными N-концевыми аминокислотами NT110 (MIMELFHTILAIVALILSSAVVSSAEISLA; SEQ ID NO:102) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT111

Указанный антиген был аннотирован как NTHI0837 в штамме 86-028NP и описан как предполагаемый липопротеин.

Приемлемые антигены NT111 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:36, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:36; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:36, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT111 включают варианты SEQ ID NO:36. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:36. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:36 при сохранении по меньшей мере одного эпитопа SEQ ID NO:36. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT111 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами NT111 (MKKTLVAALISSVILLTGC; SEQ ID NO:103) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT111 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT112

Указанный антиген был аннотирован как NTHI0849 в штамме NP96-028. Данный антиген аннотирован как липопротеин VacJ.

Приемлемые антигены NT112 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:37, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:37; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:37, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT112 включают варианты SEQ ID NO:37. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:37. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:37 при сохранении по меньшей мере одного эпитопа SEQ ID NO:37. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT112 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами NT112 (MKTKVILTALLSAIALTGC; SEQ ID NO:104) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT112 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT113

Указанный антиген был аннотирован как NTHI0921 в штамме 86-026NP и как липопротеин.

Приемлемые антигены NT113 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:38, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:38; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:38, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT113 включают варианты SEQ ID NO:38. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:38. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:38 при сохранении по меньшей мере одного эпитопа SEQ ID NO:38. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT113 по настоящему изобретению может быть экспрессирован с 16 нативными N-концевыми аминокислотами NT113 (MKKYLLLALLPFLYAC; SEQ ID NO:105) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT113 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT114

Указанный антиген был аннотирован как растворимый литический белок трансгликозилазы муреина и как NTHI0995 в штамме 86-026NP.

Приемлемые антигены NT114 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:39, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:39; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:39, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT114 включают варианты SEQ ID NO:39. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:39. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:39 при сохранении по меньшей мере одного эпитопа SEQ ID NO:39. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT114 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами NT114 (MKKVALISLCIFTALSAFA; SEQ ID NO:106) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT115

Указанный антиген был аннотирован как NTHI1091 в штамма 86-026NP и как предполагаемый липопротеин LptE. Данный антиген локализован во внеклеточной среде.

Приемлемые антигены NT115 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:40, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:40; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:40, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT115 включают варианты SEQ ID NO:40. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:40. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:40 при сохранении по меньшей мере одного эпитопа SEQ ID NO:40. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT115 по настоящему изобретению может быть экспрессирован с 35 нативными N-концевыми аминокислотами NT115 (MKYLHFTRPTIKVIFMINSIKTLLLIATLAILSAC; SEQ ID NO:107) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT115 по настоящему изобретению может быть липопротеином, например, липидированным в положении N-концевого цистеина.

Антиген NT116

Указанный антиген, аннотированный как NTHI1169 в штамме 86-026NP, относится к семейству трансферрин-связывающих белков.

Приемлемые антигены NT116 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:41, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:41; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:41, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT116 включают варианты SEQ ID NO:41. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:41. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:41 при сохранении по меньшей мере одного эпитопа SEQ ID NO:41. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT116 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT116 (MKSVPLITGGLSFLLSAC; SEQ ID NO:108) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT117

Указанный антиген был аннотирован как NTHI1208 в штамме 86-026NP и предполагаемая трансглутаминаза. Данный антиген локализован в наружной мембране.

Приемлемые антигены NT117 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:42, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:42; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:42, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT117 включают варианты SEQ ID NO:42. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:42. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:42 при сохранении по меньшей мере одного эпитопа SEQ ID NO:42. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT117 по настоящему изобретению может быть экспрессирован с 19 нативными N-концевыми аминокислотами NT117 (MKKLIAVAVFSACGLAHA; SEQ ID NO:109) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT118

Указанный антиген был аннотирован как NTHI1318 в штамме 86-026NP и как гипотетический белок.

Приемлемые антигены NT118 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:43, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:43; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:43, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT118 включают варианты SEQ ID NO:43. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:43. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:43 при сохранении по меньшей мере одного эпитопа SEQ ID NO:43. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT118 по настоящему изобретению может быть экспрессирован с 18 нативными N-концевыми аминокислотами NT118 (MNIRWNVILGVIALCALA; SEQ ID NO:110) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT119

Указанный антиген был аннотирован как гипотетический белок NTHI1565 в штамме 86-028NP.

Приемлемые антигены NT119 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:114, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:114; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:114, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT119 включают варианты SEQ ID NO:114. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:114. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:114 при сохранении по меньшей мере одного эпитопа SEQ ID NO:114. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT119 по настоящему изобретению может быть экспрессирован с 26 нативными N-концевыми аминокислотами NT119 (MRFTKTLFTTALLGASIFSFQSTAWA; SEQ ID NO:118) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT120

Указанный антиген был аннотирован как гипотетический белок NTHI1569 в штамме 86-028NP.

Приемлемые антигены NT120 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:115, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:115; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:115, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT120 включают варианты SEQ ID NO:115. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:115. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:115 при сохранении по меньшей мере одного эпитопа SEQ ID NO:115. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT120 по настоящему изобретению может быть экспрессирован с 26 нативными N-концевыми аминокислотами NT120 (MKLTKTLLTTALFGASVFSFQSTAWA; SEQ ID NO:119) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT121

Указанный антиген был аннотирован как гипотетический белок NTHI1571 в штамме 86-028NP.

Приемлемые антигены NT121 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:116, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:116; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:116, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT121 включают варианты SEQ ID NO:116. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:116. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:116 при сохранении по меньшей мере одного эпитопа SEQ ID NO:116. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT121 по настоящему изобретению может быть экспрессирован с 26 нативными N-концевыми аминокислотами NT121 (MKLTKTLLTTALLGASVFSFQSTAWA; SEQ ID NO:120) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT122

Указанный антиген был аннотирован как гипотетический белок NTHI1667 в штамме 86-028NP.

Приемлемые антигены NT122 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:117, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:117; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:117, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT122 включают варианты SEQ ID NO:117. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:117. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:117 при сохранении по меньшей мере одного эпитопа SEQ ID NO:117. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT122 по настоящему изобретению может быть экспрессирован с 23 нативными N-концевыми аминокислотами NT122 (MEKIMKKLTLALVLGSALAVTGC; SEQ ID NO:121) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT123

Указанный антиген был аннотирован как цинксодержащая протеаза NTHI1796 в штамме 86-026NP.

Приемлемые антигены NT123 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:44, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:44; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:44, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT123 включают варианты SEQ ID NO:44. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:44. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:44 при сохранении по меньшей мере одного эпитопа SEQ ID NO:44. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT123 по настоящему изобретению может быть экспрессирован с 17 нативными N-концевыми аминокислотами NT123 (MKKTTALFLLIFSLIAC; SEQ ID NO:111) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT124

Указанный антиген был аннотирован как гипотетический белок NTHI1930 в штамме 86-026NP.

Приемлемые антигены NT124 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:45, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:45; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:45, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT124 включают варианты SEQ ID NO:45. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:45. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:45 при сохранении по меньшей мере одного эпитопа SEQ ID NO:45. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT124 по настоящему изобретению может быть экспрессирован с 22 нативными N-концевыми аминокислотами NT124 (MKKSKIAAGVVISLAAVWCAGA; SEQ ID NO:89) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT061

Указанный антиген был аннотирован как SurA-подобный белок выживания NTHI0588 в штамме 86-026NP.

Приемлемые антигены NT061 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:128, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:128; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:128, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT061 включают варианты SEQ ID NO:128. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:128. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:128 при сохранении по меньшей мере одного эпитопа SEQ ID NO:128. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT061 по настоящему изобретению может быть экспрессирован с 27 нативными N-концевыми аминокислотами NT061 (MKMKKFILKSFLLATLGCVAFTSMAQA; SEQ ID NO:129) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Антиген NT017

Указанный антиген был аннотирован как SurA-подобный белок выживания NTHI0915 в штамме 86-026NP.

Приемлемые антигены NT017 могут вызывать образование антитела (например, при введении человеку), узнающего SEQ ID NO:130, и/или могут включать аминокислотную последовательность, которая (а) на 50% или больше (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) идентична SEQ ID NO:130; и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот SEQ ID NO:130, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше). Указанные белки NT017 включают варианты SEQ ID NO:130. Предпочтительные фрагменты (b) включают эпитоп из SEQ ID NO:130. В других предпочтительных фрагментах отсутствует одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении С-конца и/или одна или несколько аминокислот (например, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25 или больше) в положении N-конца SEQ ID NO:130 при сохранении по меньшей мере одного эпитопа SEQ ID NO:130. В других фрагментах отсутствует один или несколько доменов белка.

Антиген NT017 по настоящему изобретению может быть экспрессирован с 20 нативными N-концевыми аминокислотами NT017 (MLRFGVNQKTSLLLTALLSC; SEQ ID NO:131) или может быть экспрессирован с альтернативной N-концевой последовательностью, например, с простым N-концевым метионином, Met-Ala- или лидерным пептидом, обеспечивающим требуемую направленную доставку или миграцию экспрессированного белка.

Гибридные полипептиды

Полипептиды, использованные в настоящем изобретении, могут быть экспрессированы отдельно или независимо в отдельных полипептидных цепях. Альтернативно два или более полипептидов по настоящему изобретению могут быть экспрессированы в виде одной полипептидной цепи (“гибридный” полипептид). Гибридные полипептиды могут быть представлены формулой NH2-A-{-X-L-}n-B-COOH, где: А означает необязательную N-концевую аминокислотную последовательность; В означает необязательную С-концевую аминокислотную последовательность; n означает целое число, равное 2 или больше (например, 2, 3, 4, 5, 6 и т.д.), где по меньшей мере один из элементов Xn означает аминокислотную последовательность антигена по настоящему изобретению (как было описано выше); и L означает необязательную линкерную аминокислотную последовательность. В соответствии с настоящим изобретением каждый элемент Xn может включать аминокислотные последовательности антигена, выбираемого из группы, состоящей из: (1) NTHI0915 (NT018), (2) NTHI1416 (NT024), (3) NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038, но данный антиген не входит в категорию предпочтительных антигенов), (5) NTHI1292 (NT067), (6) NTHI0877 (NT001), (7) NTHI0266 (NT016), (8) CGSHiGG_00130 (NT052), (9) NTHI1627 (NT002), (10) NTHI1109 (NT026), (11) NTHI0821 (NT009), (12) NTHI0409 (NT025), (13) NTHI1954 (NT028), (14) NTHI0371 (NT029), (15) NTHI0509 (NT031), (16) NTHI0449 (NT015), (17) NTHI1473 (NT023), (18) gi-145633184 (NT100), (19) NTHI1110 (NT040), (20) gi-46129075 (NT048), (21) gi-145628236 (NT053), (22) NTHI1230 (NT066), (23) NTHI0522 (NT097), (24) Р48 (NTHI0254, также определяемый как NT007), (25) HtrA (NTHI1905, также определяемый как NT006), (26) PE (NTHI0267, также определяемый как NT035), (27) P26 (NTHI0501, также определяемый как NT010), (28) PHiD (NTHI0811, также определяемый как NT080), (29) P6 (NTHI0501, также определяемый как NT081), (30) NT013, (31) NT106, (32) NT107, (33) NT108, (34) NT109, (35) NT110, (36) NT111, (37) NT112, (38) NT113, (39) NT114, (40) NT115, (41) NT116, (42) NT117, (43) NT118, (44) NT119, (45) NT120, (46) NT121, (47) NT122, (48) NT123, (49) NT124, (50) NT004, (51) NT014, (52) NT022 (также аннотированный как NTHI0830), (53) NT016 (также аннотированный как NTHI0266).

В соответствии с настоящим изобретением Xn может включать аминокислотные последовательности двух или более антигенов, выбираемых из группы, состоящей из любых антигенов, указанных в ”первой группе антигенов”, и любых антигенов, указанных во ”второй группе антигенов”. Каждый Xn может означать аминокислотную последовательность антигена из комбинации антигенов по настоящему изобретению (описанных выше). В определенных вариантах осуществления изобретения n равно 2. Когда n равно 2, в настоящем изобретении может быть также использована любая комбинация из двух вышеописанных антигенов. Когда n равно 3, может быть использована любая комбинация по настоящему изобретению, состоящая из трех вышеописанных антигенов. Как правило, два или более Xn могут означать одинаковые антигены или, когда n равно 2, 3 или 4, каждый Xn может означать разный антиген. Когда два или более Xn означают последовательности одного и того же антигена, два или более указанных Xn могут иметь одинаковые или разные полипептидные последовательности, например, могут представлять собой разные варианты или фрагменты данного антигена.

Когда антигены определяются на основании (а) наличия 50% или более высокой идентичности (например, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) с данной последовательностью и/или (b) наличия фрагмента, состоящего по меньшей мере из ‘n’ смежных аминокислот данной последовательности, где 'n' равно 7 или больше (например 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше), степень идентичности в пункте (а) или значение 'n' в пункте (b) могут быть одинаковыми для каждого элемента Х.

В гибридном белке может присутствовать или отсутствовать последовательность лидерного пептида каждой части -Х- дикого типа. В некоторых вариантах осуществления изобретения лидерные пептиды могут быть удалены за исключением части -Х- в положении N-конца гибридного белка, то есть лидерный пептид Х1 будет сохранен, а лидерные пептиды Х2... Xn будут удалены. Такое положение равнозначно удалению всех лидерных пептидов и использованию лидерного пептида Х1 в качестве части -А-.

Во всех случаях, когда n означает {-X-L-}, может присутствовать или отсутствовать линкерная аминокислотная последовательность -L-. Например, когда n=2, гибрид может представлять собой NH2-X1-L1-X2-L2-COOH, NH2-X1-X2-COOH, NH2-X1-L1-X2-COOH, NH2-X1-X2-L2-COOH и т.д. Линкерные аминокислотные последовательности -L- обычно являются короткими (например, 20 или меньше аминокислот, то есть 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). В качестве примеров можно привести короткие пептидные последовательности, облегчающие клонирование, полиглициновые линкеры (то есть включающие Glyn, где n=2, 3, 4, 5, 6, 7, 8, 9, 10 или больше) и гистидиновые метки (то есть Hisn, где n=3, 4, 5, 6, 7, 8, 9, 10 или больше). Специалистам в данной области должны быть известны другие приемлемые линкерные аминокислотные последовательности. Приемлемым линкером является последовательность GSGGGG (SEQ ID NO:46) или GSGSGGGG (SEQ ID NO:47), при этом дипептид Gly-Ser образуется из сайта рестрикции BamHI, что облегчает клонирование и манипуляцию, и тетрапептид (Gly)4 является типичным полиглициновым линкером. Другие приемлемые линкеры, в частности, предназначенные для использования в качестве конечного Ln, включают дипептид Leu-Glu.

-А- означает необязательную N-концевую аминокислотную последовательность. Указанная последовательность обычно является короткой (например, 40 или меньше аминокислот, то есть 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). В качестве примеров можно привести лидерные последовательности, обеспечивающие направленную миграцию белка, или короткие пептидные последовательности, облегчающие клонирование или очистку (например, гистидиновые метки, то есть Hisn, где n=3, 4, 5, 6, 7, 8, 9, 10 или больше), такие как SEQ ID NO:48. Специалистам в данной области должны быть известны другие приемлемые N-концевые аминокислотные последовательности. Если в Х1 отсутствует собственный N-концевой метионин, -А- предпочтительно означает олигопептид (например, содержащий 1, 2, 3, 4, 5, 6, 7 или 8 аминокислот), который предоставляет N-концевой метионин, например, Met-Ala-Ser, или один остаток Met.

-В- означает необязательную С-концевую аминокислотную последовательность. Указанная последовательность обычно является короткой (например, 40 или меньше аминокислот, то есть 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15, 14, 13, 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1). В качестве примеров можно привести последовательности, обеспечивающие направленную миграцию белка, короткие пептидные последовательности, облегчающие клонирование или очистку (например, включающие гистидиновые метки, то есть Hisn, где n=3, 4, 5, 6, 7, 8, 9, 10 или больше, такие как SEQ ID NO:68), или последовательности, повышающие устойчивость белка. Специалистам в данной области должны быть известны другие приемлемые С-концевые аминокислотные последовательности.

Штаммы и варианты

Антигены обозначены в настоящем описании изобретения в соответствии с правилами наименования, принятыми в научной литературе, например, с использованием нумерации “NTHI” (из генома штамма 86-028NP) или нумерации CGSHiGG (из генома штамма PittGG). Такие правила более подробно рассмотрены в ссылке 15 (в частности, в таблице 1). В таблице V, приведенной в настоящем описании изобретения, существующая номенклатура соотносится с номенклатурой ”NT”, использованной в настоящем изобретении. Таким образом, типичные аминокислотные и нуклеотидные последовательности для любых антигенов по настоящему изобретению могут быть легко найдены в общедоступным базах данных последовательностей для указанных штаммов (вместе с дополнительной информацией, такой как аннотации функциональных характеристик), но настоящее изобретение не ограничено последовательностями из штаммов 86-028NP, 3655 или PittGG. Существуют геномные последовательности нескольких других штаммов NTHI (см. таблицу 1 в ссылке 15). Для идентификации гомологов любых указанных (или других) геномных последовательностей по настоящему изобретению могут быть использованы стандартные методы поиска и сравнительного анализа. Кроме того, существующие последовательности могут быть использованы для создания затравок для амплификации гомологичных последовательностей из других штаммов. Таким образом, настоящее изобретение не ограничено указанными конкретными штаммами, и в объем изобретения входят варианты и гомологи из других штаммов NTHI, а также неприродные варианты. Как правило, приемлемые варианты конкретной последовательности включают ее аллельные варианты, полиморфные формы, гомологи, ортологи, паралоги, мутанты и т.д. Например, SEQ ID NO:49, 52, 54, 55, 57-59, 64, 65 и 67 включают описанные ниже мутации.

Например, полипептиды, используемые в настоящем изобретении, могут включать одну или несколько (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 и т.д.) замен аминокислот, в частности, консервативных замен (то есть замен одной аминокислоты другой аминокислотой, имеющей родственную боковую цепь). Генетически кодированные аминокислоты обычно подразделяются на четыре семейства: (1) кислотные, то есть аспартат, глутамат; (2) основные, то есть лизин, аргинин, гистидин; (3) неполярные, то есть аланин, валин, лейцин, изолейцин, пролин, фенилаланин, метионин, триптофан; и (4) незаряженные полярные, то есть глицин, аспарагин, глутамин, цистеин, серин, треонин, тирозин. Фенилаланин, триптофан и тирозин иногда классифицируются как ароматические аминокислоты. Как правило, замена единичной аминокислоты в указанных семействах не оказывает значительного влияния на биологическую активность. Полипептиды могут также включать одну или несколько (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 и т.д.) делеций единичных аминокислот по сравнению с указанными последовательностями. Полипептиды могут также включать одну или несколько (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 и т.д.) инсерций (например, 1, 2, 3, 4 или 5 аминокислот) по сравнению с указанными последовательностями.

Аналогичным образом полипептид, используемый в настоящем изобретении, может включать амиинокислотную последовательность, которая:

(а) полностью идентична (то есть идентична на 100%) последовательности, приведенной в списке последовательностей;

(b) неполностью идентична (например, идентична на 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше) последовательности, приведенной в списке последовательностей;

(с) содержит 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10 (или больше) изменений единичных аминокислот (делеций, инсерций, замен), которые могут находиться в удаленных друг от друга или смежных положениях по сравнению с последовательностями (а) или (b); и/или

(d) при сравнении с конкретной последовательностью из списка последовательностей при помощи алгоритма попарного сравнения каждое окно х аминокислот, перемещающееся от N-конца к С-концу (аналогично сравнительному анализу, охватывающему р аминокислот, где p>x, существует р-х+1 таких окон), содержит по меньшей мере х.у идентичных аминокислот, где х выбирают из 20, 25, 30, 35, 40, 45, 50, 60, 70, 80, 90, 100, 150, 200; у выбирают из 0,50, 0,60, 0,70, 0,75, 0,80, 0,85, 0,90, 0,91, 0,92, 0,93, 0,94, 0,95, 0,96, 0,97, 0,98, 0,99; и, если произведение х.у не равно целому числу, оно округляется до ближайшего целого числа. Предпочтительным алгоритмом попарного сравнения является алгоритм глобального сравнения Нидлмана-Ванша [16] с использованием параметров по умолчанию (например, штраф за открытый разрыв=10,0 и штраф за удлинение разрыва=0,5 при использовании оценочной матрицы EBLOSUM62). Указанный алгоритм обычно применяется в вспомогательной программе needle пакета программ EMBOSS [17].

При использовании гибридных полипептидов отдельные антигены в гибриде (то есть отдельные -Х- части) могут быть получены из одного или нескольких штаммов. Когда n=2, Х2 может быть выделен из того же штамма, что и Х1, или из другого штамма. Когда n=3, могут быть использованы следующие штаммы: (i) Х123, (ii) Х12≠Х3, (iii) Х1≠Х23, (iv) Х1≠Х2≠Х3 или (v) Х13≠Х2 и т.д.

Делеции и замены в группе (с) могут быть выполнены в положении N-конца и/или С-конца или между двух концов. Таким образом, усечение является примером делеции. Усечения могут включать делецию до 40 (или больше) аминокислот в положении N-конца и/или С-конца. В результате усечения N-конца могут быть удалены лидерные пептиды, например, для облегчения рекомбинантной экспрессии в гетерологичном хозяине. В результате усечения С-конца могут быть удалены якорные последовательности, например, для облегчения рекомбинантной экспрессии в гетерологичном хозяине.

Как правило, когда антиген включает последовательность, которая не идентична последовательности NTHI из списка последовательностей (например, когда антиген включает последовательность, которая менее чем на 100% идентична последовательности в списке последовательностей, или когда антиген включает фрагмент указанной последовательности), в каждом отдельном случае желательно, чтобы антиген мог образовывать антитело, способное узнавать соответствующую последовательность NTHI из списка последовательностей.

Бактерии-мутанты

Настоящее изобретение также относится к бактерии NTHi, в которой удален один или несколько антигенов по настоящему изобретению [18]. Методы создания бактерий с выбитыми генами хорошо известны, и выбивание генов из штаммов NTHi описано, например, в ссылке 19. Мутация с выбитым геном может находиться в кодирующей области гена или в регуляторных областях транскрипции (например, в промоторе). Мутация с выбитым геном снижает уровень мРНК, кодирующей антиген, до <1% от уровня, продуцируемого бактерией дикого типа, предпочтительно до <0,5%, более предпочтительно до <0,1% и наиболее предпочтительно до 0%.

Настоящее изобретение также относится к бактерии NTHI, в которой один или несколько антигенов по настоящему изобретению содержат мутацию, подавляющую их активность. Ген, кодирующий антиген, будет иметь мутацию, которая изменяет кодированную аминокислотную последовательность или отменяет его экспрессию. Мутация может включать делецию, замену и/или инсерцию, которые могут охватывать одну или несколько аминокислот.

Один вариант осуществления изобретения относится к делециям одного или нескольких генов, кодирующих антигены по настоящему изобретению.

Известно, что в E. coli два компонента механизма деления с доменами LytM (EnvC и NlpD) являются прямыми регуляторами гидролаз (амидаз) клеточной стенки, отвечающими за разделение клеток (AmiA, AmiB и AmiC) [20]. Также известно, что металлопротеазы LytM в Е. coli абсолютно необходимы для отделения дочерних клеток.

Один вариант осуществления изобретения относится к генам NTHI, кодирующим полипептиды, содержащим каталитический домен LytM. Металлопротеазы обычно содержат домены аминокислот НхН и HxxxD в каталитических доменах. Указанные один или несколько генов предпочтительно кодируют любой антиген NT013, NT022 или NT017.

В соответствии с настоящим изобретением мутация или делеция одного или нескольких генов, кодирующих полипептиды, содержащие каталитический домен LytM, существенно изменяют деление бактериальных клеток и фенотип бактерии.

Кроме того, было установлено, что указанная мутация или делеция вызывает высвобождение пузырьков, известных как OMV или пузырьки наружной мембраны, хотя те же штаммы NTHi дикого типа обычно не высвобождают OMV.

В соответствии с одним особенно предпочтительным вариантом осуществления изобретения делеция NT013 и/или NT022 не только влияет на деление бактериальных клеток, но также вызывает образование и высвобождение пузырьков наружной мембраны (OMV) в штаммах NTHI, которые обычно не высвобождают OMV.

Предпочтительные варианты осуществления изобретения относятся к штаммам NTHI, содержащим делеции одного или нескольких генов, кодирующих любой антиген NT013, NT022 или NT017. Например, удаленные гены могут быть заменены кластером устойчивости к антибиотикам, например, кластером устойчивости к эритромицину. Установлено, что все вышеуказанные полипептиды содержат каталитический домен LytM и являются металлопротеазами.

Также было установлено, что домен LytM в антигенах NT013 и NT022 является консервативным. Активный каталитический сайт NT013 представлен следующими аминокислотными фрагментами -HKGD- и -HLH- в положении С-конца. Активный каталитический сайт NT022 представлен следующими аминокислотными фрагментами -NKGID- и -KLH- в положении С-конца.

Настоящее изобретение также относится к бактерии, такой как бактерия NTHi, которая сверхэкспрессирует антиген по настоящему изобретению.

Настоящее изобретение также относится к бактерии, такой как бактерия NTHi, которая конститутивно экспрессирует антиген по настоящему изобретению. Настоящее изобретение также относится к Е. coli, включающему по меньшей мере один ген, кодирующий антиген по настоящему изобретению, при этом указанный ген контролируется индуцибельным промотором.

Вакцина на основе OMV

Грамотрицательные бактерии отделены от внешней среды двумя слоями мембранных структур. Указанные структуры, определяемые как цитоплазматическая мембрана и наружная мембрана (ОМ), отличаются в структурном и функциональном отношении. Наружная мембрана имеет важное значение для взаимодействия патогенной бактерии с соответствующими хозяевами. Поэтому экспонированные на поверхности молекулы бактерий являются важными мишенями для иммунной реакции хозяина, что делает компоненты наружной мембраны привлекательными кандидатами для создания вакцины, диагностических и терапевтических реагентов.

Бактерии-мутанты по настоящему изобретению особенно пригодны для получения пузырьков наружной мембраны бактерии, включающих антигены NTHi (например, антигены по настоящему изобретению), которые могут быть использованы в качестве иммуногенов.

Настоящее изобретение относится также к бактерии, такой как бактерия NTHi, которая сверхэкспрессирует по меньшей мере один антиген по настоящему изобретению, предпочтительно в результате сверхпродуцирования OMV.

Увеличение продуцирования OMV может быть использовано для повышения уровней приемлемых белков NTHi в пузырьках наружной мембраны (OMV).

Настоящее изобретение также относится к способу создания бактерии NTHi, сверхпродуцирующей OMV по настоящему изобретению, который включает генетическую модификацию штамма грамотрицательных бактерий с помощью одного или нескольких следующих процессов: (а) создание штамма с пониженной экспрессией одного или нескольких генов Tol; (b) мутация одного или нескольких генов, кодирующих белок, включающий пептидогликан-ассоциированный сайт, для ослабления пептидогликан-связывающей активности белка; (с) мутация или делеция одного или нескольких генов, кодирующих полипептиды, содержащие каталический домен LytM. В одном особенно предпочтительном варианте осуществления изобретения NTHi не может экспрессировать активные гены NT013, NT022 и/или любые гены Tol [19], [18].

Настоящее изобретение также относится к способу получения пузырька NTHi, который включает стадию обработки бактерии NTHI по настоящему изобретению, вызывающей образование пузырьков наружной мембраной.

Настоящее изобретение также относится к способу получения пузырька NTHi, который включает стадию культивирования бактерии NTHi по настоящему изобретению в условиях, в которых наружная мембрана спонтанно выделяет пузырьки.

Настоящее изобретение также относится к бактерии NTHi, которая сверхпродуцирует OMV и сверхэкспрессирует антигены по настоящему изобретению.

Полипептиды, используемые в настоящем изобретении

В настоящем изобретении могут быть использованы полипептиды разных типов (например, нативные, гибридизированные, гликозилированные, негликозилированные, липидированные, нелипидированные, фосфорилированные, нефосфорилированные, миристоилированные, немиристоилированные, мономерные, мультимерные, в виде частиц, денатурированные и т.д.)

Полипептиды, используемые в настоящем изобретении, могут быть получены разными способами (например, методом рекомбинантной экспрессии, очистки из культуры клеток, химического синтеза и т.д.). Наиболее предпочтительными являются рекомбинантно экспрессированные белки, особенно для гибридных полипептидов.

Полипептиды, используемые в настоящем изобретении, предпочтительно получают в очищенной или по существу очищенной форме, то есть по существу свободной от других полипептидов (например, при отсутствии природных полипептидов), в частности, от других полипептидов H. influenzae или клетки-хозяина, с чистотой, равной по меньшей мере примерно 50% (по массе), и обычно примерно 90%, то есть менее примерно 50% или более предпочтительно менее примерно 10% (например, 5%) композиции состоит из других экспрессированных полипептидов. Таким образом, антигены в композициях отделены от всего организма, в котором данная молекула была экспрессирована.

Термин ”полипептид” означает аминокислотные полимеры любой длины. Полимер может быть линейным или разветвленным, может включать модифицированные аминокислоты, и цепь полимера может прерываться кислотами, отличными от аминокислот. В определение данного термина также входит аминокислотный полимер, который был модифицирован естественным или искусственным путем, например, в результате образования дисульфидных связей, гликозилирования, липидирования, ацетилирования, фосфорилирования или любой другой манипуляции или модификации, такой как конъюгация с меткой. Указанный термин также означает полипептиды, содержащие один или несколько аналогов аминокислот (включающих, например, неприродные аминокислоты и т.д.), а также другие модификации, известные в данной области. Полипептиды могут включать отдельные цепи или ассоциированные цепи.

Полипептиды, используемые в настоящем изобретении, могут включать последовательность -Р-Q- или -Q-Р-, где -Р- означает вышеуказанную аминокислотную последовательность и -Q- не является вышеуказанной последовательностью, то есть может представлять собой слитые белки. Когда N-концевой кодон -Р- не является ATG и отсутствует в положении N-конца полипептида, указанный кодон транслируется как стандартная аминокислота для данного кодона, а не как Met. Однако, когда указанный кодон присутствует в положении N-конца полипептида, данный кодон транслируется как Met. Примеры частей -Q- включают, не ограничиваясь ими, гистидиновые метки (то есть Hisn, где n=3, 4, 5, 6, 7, 8, 9, 10 или больше, например, SEQ ID NO:68), мальтоза-связывающий белок или глутатион-S-трансферазу (GST).

Полипептиды, используемые в настоящем изобретении, могут включать последовательность -Р-Q- или -Q-Р- в случае первичной экспрессии в качестве зарождающегося белка, но в некоторых вариантах осуществления изобретения часть -Q- может отсутствовать в белке на данной стадии, например, лидерный пептид может быть расщеплен после трансляции.

Приемлемой N-концевой последовательностью для экспрессии является SEQ ID NO:48.

Хотя полипептиды, используемые в настоящем изобретении, могут быть экспрессированы в H. influenzae, обычно для экспрессии используют гетерологичный хозяин (рекомбинантная экспрессия). Гетерологичный хозяин может быть прокариотическим (например, бактерией) или эукариотическим организмом. Таким организмом может быть E. coli, но другие приемлемые хозяева включают Bacillus subtilis, Vibrio cholerae, Salmonella typhi, Salmonella typhimurium, Neisseria lactamica, Neisseria cinerea, Mycobacteria (например, M. tuberculosis), дрожжи и т.д. По сравнению с генами H. influenzae дикого типа, кодирующими полипептиды по настоящему изобретению, полезно заменить кодоны для оптимизации эффективности экспрессии в таких хозяевах, не оказывая воздействия на кодированные аминокислоты.

Полипептиды, используемые в настоящем изобретении, могут быть синтезированы способом, включающим стадию химического синтеза по меньшей мере части полипептида.

Нуклеиновые кислоты

Настоящее изобретение также относится к нуклеиновым кислотам (например, комбинациям нуклеиновых кислот, векторам или комбинациям векторов), кодирующим полипептиды, используемые в настоящем изобретении, комбинации полипептидов или гибридные полипептиды по настоящему изобретению. Настоящее изобретение также относится к нуклеиновым кислотам, включающим нуклеотидную последовательность, кодирующую один или несколько (например, 2, 3 или 4) полипептидов или гибридных полипептидов антигенных комбинаций по настоящему изобретению. Нуклеиновая кислота может быть, например, вектором (например, клонирующим или экспрессирующим вектором).

Нуклеотидные последовательности, кодирующие полипептиды одного или нескольких (по меньшей мере одного) антигенов и антигенных комбинаций по настоящему изобретению, хорошо известны (см., например, ссылки 6-9) или могут быть созданы в соответствии с генетическим кодом. Таким образом, в контексте настоящего изобретения такая нуклеотидная последовательность может кодировать один или несколько антигенов (1) NTHI0915 (NT018), (2) NTHI1416 (NT024), (3) NTHI2017 (NT032), (4) CGSHiGG_02400 (NT038), (5) NTHI1292 (NT067), (6) NTHI0877 (NT001), (7) NTHI0266 (NT016), (8) CGSHiGG_00130 (NT052), (9) NTHI1627 (NT002), (10) NTHI1109 (NT026), (11) NTHI0821 (NT009), (12) NTHI0409 (NT025), (13) NTHI1954 (NT028), (14) NTHI0371 (NT029), (15) NTHI0509 (NT031), (16) NTHI0449 (NT015), (17) NTHI1473 (NT023), (18) gi-145633184 (NT100), (19) NTHI1110 (NT040), (20) gi-46129075 (NT048), (21) gi-145628236 (NT053), (22) NTHI1230 (NT066), (23) NTHI0522 (NT097) или антиген Р48 (такой как SEQ ID NO:24), антиген HtrA (такой как SEQ ID NO:25), антиген РЕ (такой как SEQ ID NO:26), антиген Р26 (такой как SEQ ID NO:27), антиген PHiD (такой как SEQ ID NO:28), антиген Р6 (такой как SEQ ID NO:29), (24) NT004, (25) NT014, (26) NT022 или один или несколько антигенов из ”третьей группы антигенов” или может кодировать аминокислотную последовательность, которая (а) на 50% или больше идентична вышеуказанным полипептидам (например, на 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99,5% или больше, например, идентичная на 90% или больше, идентична на 95% или больше либо идентична на 99% или больше); и/или (b) включает фрагмент, состоящий по меньшей мере из 'n' смежных аминокислот любых указанных полипептидов, где 'n' равно 7 или больше (например, 8, 10, 12, 14, 16, 18, 20, 25, 30, 35, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250 или больше, например, 20 или больше; или, например, 50 или больше; или, например, 80 или больше).

Настоящее изобретение также относится к нуклеиновой кислоте, которая может гибридизировать с указанными нуклеиновыми кислотами. Реакции гибридизации могут быть выполнены в условиях разной ”строгости”. Условия увеличения строгости реакции гибридизации широко известны и опубликованы в данной области (например, страница 752 ссылки 121). Примеры соответствующих условий включают (в порядке увеличения строгости) температуры инкубации: 25°С, 37°С, 50°С, 55°С и 68°С; концентрации буферов: 10-кратный SSC, 6-кратный SSC, 1-кратный SSC, 0,1-кратный SSC (где SSC включает 0,15 М NaCl и 15 мМ цитратного буфера) и их эквиваленты при использовании других буферных систем; концентрации формамида: 0%, 25%, 50% и 75%; время инкубации от 5 минут до 24 часов; 1, 2 или более стадий промывки; время промывки: 1, 2 или 15 минут; и промывочные растворы: 6-кратный SSC, 1-кратный SSC, 0,1-кратный SSC или деионизированная вода. Методы гибридизации и оптимизации хорошо известны в данной области (см., например, ссылки 21, 22 и 123).

Нуклеиновая кислота может гибридизировать с мишенью в условиях пониженной строгости; в других вариантах осуществления изобретения нуклеиновая кислота гибридизирует в условиях средней строгости; в предпочтительных вариантах осуществления изобретения нуклеиновая кислота гибридизирует в строгих условиях. Типичная совокупность параметров гибридизации в условиях пониженной строгости включает 50°С и 10-кратный SSC. Типичная совокупность параметров гибридизации в условиях средней строгости включает 55°С и 1-кратный SSC. Типичная совокупность параметров гибридизации в строгих условиях включает 68°С и 0,1-кратный SSC.

Настоящее изобретение относится к нуклеиновой кислоте, включающей последовательности, комплементарные указанным последовательностям (например, антисмысловые или зондирующие последовательности, а также затравки).

Нуклеиновая кислота по настоящему изобретению может быть использована в разных формах (например, одноцепочечная, двухцепочечная, векторы, затравки, зонды, меченые и т.д.). Нуклеиновые кислоты по настоящему изобретению могут быть циклическими или разветвленными, но обычно являются линейными. За исключением особо оговоренных случаев или случаев, определяемых потребностью, в любом варианте осуществления изобретения, в котором использована нуклеиновая кислота, такая нуклеиновая кислота может иметь двухцепочечную конфигурацию или любую из двух комплементарных одноцепочечных конфигураций, образующих двухцепочечную конфигурацию. Затравки и зонды обычно являются одноцепочечными, как и антисмысловые нуклеиновые кислоты.

Нуклеиновые кислоты, кодирующие антигены по настоящему изобретению, предпочтительно получают в очищенном или по существу очищенном виде, то есть по существу свободными от других нуклеиновых кислот (например, при отсутствии природных нуклеиновых кислот), в частности, от других нуклеиновых кислот H. influenzae или клетки-хозяина, как правило, с чистотой, равной по меньшей мере примерно 50% (по массе), и обычно по меньшей мере примерно 90%. Нуклеиновые кислоты по настоящему изобретению предпочтительно являются нуклеиновыми кислотами H. influenzae.

Нуклеиновые кислоты, кодирующие антигены по настоящему изобретению, могут быть получены многими способами, например, в результате полного или неполного химического синтеза (например, фосфорамидитного синтеза ДНК), расщепления более длинных нуклеиновых кислот нуклеазами (например, рестрикционными ферментами), соединения более коротких нуклеиновых кислот или нуклеотидов (например, при помощи лигаз или полимераз), из геномных библиотек или библиотек кДНК и т.д.

Нуклеиновые кислоты могут быть присоединены к твердой подложке (такой как, например, гранула, пластина, фильтр, пленка, предметное стекло, микроматрица, смола и т.д.). Нуклеиновые кислоты могут быть помечены, например, радиоактивной или флуоресцентной меткой, биотиновой меткой. Такое мечение является особенно полезным при использовании нуклеиновой кислоты в детектирующих методах, например, при использовании нуклеиновой кислоты в качестве затравки или зонда.

Термин ”нуклеиновая кислота” обычно означает полимерную форму нуклеотидов любой длины, включающих дезоксирибонуклеотиды, рибонуклеотиды и/или их аналоги. Нуклеиновая кислота включает ДНК, РНК, гибриды ДНК/РНК. Нуклеиновая кислота также включает аналоги ДНК или РНК, например, содержащие модифицированные остовы (например, нуклеиновые кислоты пептидов (PNA) или фосфортиоаты) или модифицированные основания. Таким образом, в объем настоящего изобретения входят мРНК, тРНК, рРНК, рибозимы, ДНК, кДНК, рекомбинантные нуклеиновые кислоты, разветвленные нуклеиновые кислоты, плазмиды, векторы, зонды, затравки и т.д. В нуклеиновой кислоте по настоящему изобретению, являющейся РНК, может присутствовать или отсутствовать 5'-кэп.

Нуклеиновые кислоты, кодирующие антигены по настоящему изобретению, могут быть частью вектора, то есть частью конструкции нуклеиновой кислоты, созданной для трансдукции/трансфекции клеток одного или нескольких типов. Векторы могут быть, например, ”клонирующими векторами”, предназначенными для выделения, размножения и репликации вставленных нуклеотидов, ”экспрессирующими векторами”, предназначенными для экспрессии нуклеотидной последовательности в клетке-хозяине, ”вирусными векторами”, предназначенными для продуцирования рекомбинантного вируса или вирусоподобной частицы, или ”шаттл-векторами”, включающими признаки векторов нескольких типов. Предпочтительными векторами являются плазмиды. ”Клетка-хозяин” представляет собой единичную клетку или культуру клеток, которая может быть реципиентом экзогенной нуклеиновой кислоты. Клетки-хозяева включают потомство единичной клетки-хозяина, при этом потомство необязательно должно быть полностью идентично (в отношении морфологии или общего комплемента ДНК) исходной клетке-хозяину вследствие природных, случайных или намеренных мутаций и/или изменений. Клетки-хозяева включают клетки, трансфицированные или инфицированные in vivo или in vitro нуклеиновой кислотой по настоящему изобретению.

Термин ”комплемент” или “комплементарный” применительно к нуклеиновым кислотам означает спаривание оснований Ватсона-Крика. Таким образом, комплементом С является G, комплементом G является С, комплементом А является Т (или U) и комплементом Т (или U) является А. В качестве комплементов пиримидинов (С или Т), например, также могут быть использованы основания, такие как I (инозин пурина).

Нуклеиновые кислоты, кодирующие антигены по настоящему изобретению, могут быть использованы, например, для продуцирования полипептидов, в качестве гибридизирующих зондов для обнаружения нуклеиновой кислоты в биологических образцах, для создания дополнительных копий нуклеиновых кислот, для получения рибозим или антисмысловых олигонуклеотидов, в качестве одноцепочечных затравок или зондов ДНК или для образования трехцепочечных олигонуклеотидов.

Настоящее изобретение относится к способу получения нуклеиновой кислоты, кодирующей антигены по настоящему изобретению, который включает полный или неполный химический синтез нуклеиновой кислоты.

Настоящее изобретение относится к векторам, включающим нуклеотидные последовательности, кодирующие антигены по настоящему изобретению (например, к клонирующим или экспрессирующим векторам), и к клеткам-хозяевам, трансформированным такими векторами.

В определенных вариантах осуществления изобретения нуклеиновые кислоты предпочтительно включают по меньшей мере 7 нуклеотидов (например, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 45, 50, 55, 60, 65, 70, 75, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 225, 250, 275, 300 нуклеотидов).

В определенных вариантах осуществления изобретения нуклеиновые кислоты предпочтительно включают самое большее 500 нуклеотидов (например, 450, 400, 350, 300, 250, 200, 150, 140, 130, 120, 110, 100, 90, 80, 75, 70, 65, 60, 55, 50, 45, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31, 30, 29, 28, 27, 26, 25, 24, 23, 22, 21, 20, 19, 18, 17, 16, 15 нуклеотидов или меньше).

Иммуногенные композиции и лекарственные средства

Иммуногенные композиции по настоящему изобретению могут быть использованы в качестве вакцин. Вакцины по настоящему изобретению могут быть профилактическими (то есть предназначенными для предотвращения инфекционного заболевания) или терапевтическими (то есть предназначенными для лечения инфекционного заболевания), но обычно являются профилактическими.

Таким образом, композиции могут быть фармацевтически приемлемыми. Помимо антигенов композиции включают дополнительные компоненты, например, такие композиции обычно включают один или несколько фармацевтических носителей и/или наполнителей. Такие компоненты всесторонне рассмотрены в ссылке 118.

Композиции обычно вводят млекопитающему в водной форме. Однако до введения композиция может представлять собой неводную форму. Например, некоторые вакцины производят в водной форме, затем расфасовывают, распространяют и вводят также в водной форме, другие вакцины лиофилизируют в процессе производства и восстанавливают в водной форме во время использования. Таким образом, композиция по настоящему изобретению может быть высушена, как, например, лиофилизированный препарат.

Композиция может включать консерванты, такие как тиомерсаль или 2-феноксиэтанол. Однако, желательно, чтобы вакцина по существу не содержала (то есть менее 5 мкг/ил) ртути, то есть тиомерсаля. Вакцины, не содержащие ртути, являются более предпочтительными. Особенно предпочтительными являются вакцины без консервантов.

Для улучшения теплостойкости композиция может включать термозащитный агент. Такие агенты более подробно описаны ниже.

Для контроля тоничности желательно использовать физиологическую соль, такую как соль натрия. Предпочтительным является хлорид натрия (NaCl), который может присутствовать в количестве от 1 до 20 мг/мл, например, примерно 10±2 мг/мл NaCl. Другие соли, которые могут быть использованы в композиции, включают хлорид калия, дигидрофосфат калия, динатрийдигидрофосфат, хлорид магния, хлорид кальция и т.д.

Осмотическая концентрация композиций обычно составляет от 200 мОсм/кг до 400 мОсм/кг, предпочтительно 240-360 мОсм/кг и более предпочтительно находится в диапазоне 290-310 мОсм/кг.

Композиции могут включать один или несколько буферов. Типичными буферами являются фосфатный буфер, трис-буфер, боратный буфер, сукцинатный буфер, гистидиновый буфер (в частности, с адъювантом, являющимся гидроксидом алюминия) или цитратный буфер. Буферы обычно используют в количестве 5-20 мМ.

Значение рН композиции обычно находится в пределах от 5,0 до 8,1, более предпочтительно в пределах от 6,0 до 8,0, например, от 6,5 до 7,5 или от 7,0 до 7,8.

Композиция предпочтительно является стерильной. Композиция предпочтительно является апирогенной, например, содержащей <1 EU (эндотоксиновая единица, стандартная мера) на дозу, предпочтительно <0,1 EU/дозу. Композиция предпочтительно не содержит глютена.

Композиция может содержать вещество для одной иммунизации или нескольких иммунизаций (то есть упаковка ”для многократного применения”). В лекарственное средство для многократного применения предпочтительно вводят консервант. В качестве альтернативы (или дополнительно) введения консерванта в композиции для многократного применения может быть использован контейнер с асептическим адаптером для удаления необходимого количества вещества.

Вакцины, предназначенные для человека, обычно вводят в дозе около 0,5 мл, при этом детям может быть введена половина дозы (то есть примерно 0,25 мл).

Иммуногенные композиции по настоящему изобретению могут также включать один или несколько иммунорегуляторных агентов. Один или несколько иммунорегуляторных агентов предпочтительно включают один или несколько адъювантов. Адъюванты могут включать адъювант ТН1 и/или адъювант ТН2, рассмотренные ниже.

Адъюванты, которые могут быть использованы в композициях по настоящему изобретению, включают, не ограничиваясь ими:

- минеральные соли, такие как соли алюминия и соли кальция, в том числе гидроксиды (например, оксигидроксиды), фосфаты (например, гидроксифосфаты, ортофосфаты), сульфаты и т.д. [см., например, главы 8 и 9 ссылки 23];

- эмульсии масла в воде, такие как эмульсии сквалена в воде, включающие MF59 (5% сквалена, 0,5% твина-80 и 0,5% спана-85, полученные в виде субмикронных частиц при помощи микрофлюидизатора) (глава 10 ссылки 23; см. также ссылки 24-26 и главу 12 ссылки 27), полный адъювант Фрейнда (CFA) и неполный адъювант Фрейнда (IFA);

- препараты сапонина [глава 22 ссылки 23], такие как QS21 [28] и ISCOM [глава 23 ссылки 23];

- виросомы и вирусоподобные частицы (VLP) [29-35];

- бактериальные и микробные производные, такие как нетоксичные производные липополисахаридов энтеробактерий (LPS), производные липида А [36, 37], иммуностимулирующие олигонуклеотиды [38-43], такие как IC-31™ [44] (дезоксинуклеотид, включающий 26-членную последовательность 5'-(IC)13-3' (SEQ ID NO:112) и поликатионный полипептид, включающий 11-членную аминокислотную последовательность KLKLLLLLKLK (SEQ ID NO:113) и ADP-рибозилированные токсины и их детоксифицированные производные [45-54];

- человеческие иммуномодуляторы, включающие цитокины, такие как интерлейкины (например, IL-1, IL-2, IL-4, IL-5, IL-6, IL-7, IL-12 [55, 56], интерфероны (например, γ-интерферон), колониестимулирующий фактор макрофагов и фактор некроза опухолей;

- биоадгезивы и мукоадгезивы, такие как хитозан и его производные, микросферы этерифицированной гиалуроновой кислоты [57] или мукоадгезивы, такие как перекрестносшитые производные полиакриловой кислоты, поливиниловый спирт, поливинилпирролидон, полисахариды и карбоксиметилцеллюлоза [58];

- микрочастицы (то есть частица с диаметром от ~100 нм до ~150 мкм, более предпочтительно с диаметром от ~200 нм до ~30 мкм и наиболее предпочтительно с диаметром от ~500 нм до ~10 мкм), образованные из биоразрушаемых и нетоксичных веществ (например, поли-α-оксикислоты, полигидроксимасляной кислоты, полиортоэфира, полиангидрида, поликапролактона и т.д.);

- липосомы [главы 13 и 14 ссылки 23, ссылки 59-61];

- простые эфиры полиоксиэтилена и сложные эфиры полиоксиэтилена [62];

- препараты РСРР [63 и 64];

- мурамилпептиды, включающие N-ацетилмурамил-L-треонил-D-изоглутамин (thr-MDP), N-ацетилнормурамил-l-аланил-d-изоглутамин (nor-MDP) и N-ацетилмурамил-l-аланил-d-изоглутаминил-l-аланин-2-(1'-2'-дипальмитоил-sn-глицеро-3-гидроксифосфорилокси)этиламин (МТР-РЕ); и

- соединения имидазохинолона, включающие имиквамод и его гомологи (например, ”резиквимод 3М”) [65 и 66].

Иммуногенные композиции и вакцины по настоящему изобретению могут также включать комбинации одного или нескольких вышеуказанных адъювантов. Например, в настоящем изобретении могут быть использованы следующие композиции адъювантов: (1) сапонин и эмульсия масла в воде [67]; (2) сапонин (например, QS21) + нетоксичное производное LPS (например, 3dMPL) [68]; сапонин (например, QS21) + нетоксичное производное LPS (например, 3dMPL) + холестерин; (4) сапонин (например, QS21) + 3dMPL + IL-12 (необязательно + стерол) [69]; (5) комбинации 3dMPL, например, с QS21 и/или эмульсиями масла в воде [70]; (6) SAF, содержащий 10% сквалена, 0,4% твина-80™, 5% блоксополимера L121 и thr-MDP, микрофлюидизированные с образованием эмульсии с частицами в субмикронном диапазоне или интенсивно перемешанные с образованием эмульсии с частицами более крупного размера. (7) Система адъювантов Ribi™ (RAS) (Ribi Immunochem), содержащая 2% сквалена, 0,2% твина-80 и один или несколько компонентов оболочки бактериальной клетки, выбираемых из группы, состоящей из монофосфорлипида А (MPL), трегалозодимиколата (TDM) и каркаса клеточной оболочки (CWS), предпочтительно MPL + CWS (Detox™); и (8) одна или несколько минеральных солей (таких как соль алюминия) + нетоксичное производное LPS (такое как 3dMPL).

Другие вещества, действующие в качестве иммуностимулирующих агентов, рассмотрены в главе 7 ссылки 23.

Особенно предпочтительными в качестве адъювантов являются гидроксид алюминия и/или фосфат алюминия, так как антигены обычно адсорбируются указанными солями. Фосфат кальция является еще одним предпочтительным адъювантом. Другие предпочтительные комбинации адъювантов включают комбинации адъювантов Th1 и Th2, такие как CpG и квасцы или резиквимод и квасцы. Может быть использована комбинация фосфата алюминия и 3dMPL (указанная комбинация была признана эффективной при иммунизации против пневмококка [71]). Использование MF59 является предпочтительным в случае внутримышечной (IM) или внутрибрюшинной (IP) иммунизации.

Композиции по настоящему изобретению могут индуцировать как клеточно-опосредованную иммунную реакцию, так и гуморальную иммунную реакцию. Указанная иммунная реакция вызывает образование долговременных (например, нейтрализующих) антигенов и клеточно-опосредованного иммунитета, который может быстро реагировать на NTHI.

Обычно считается, что для индукции и/или усиления клеточно-опосредованного иммунитета и гуморального иммунитета необходимы Т-клетки двух типов, CD4 и CD8 клетки. CD8 Т-клетки могут экспрессировать корецептор CD8 и обычно определяются как цитотоксические Т-лимфоциты (CTL). CD8 Т-клетки способны узнавать и взаимодействовать с антигенами, отображаемыми на молекулах МНС I класса.

CD4 Т-клетки могут экспрессировать корецептор CD4 и обычно определяются как Т-клетки-хелперы. CD4 Т-клетки способны узнавать антигенные пептиды, связанные с молекулами МНС II класса. При взаимодействии с молекулой МНС II класса D4 клетки могут секретировать такие факторы как цитокины. Секретированные цитокины могут активировать В-клетки, цитотоксические Т-клетки, макрофаги и другие клетки, участвующие в иммунной реакции. Т-клетки-хелперы или CD4+ клетки могут быть далее разделены на две функционально разные субпопуляции: фенотип ТН1 и фенотип ТН2, которые отличаются цитокинами и эффекторной функцией.

Активированные ТН1 клетки усиливают клеточный иммунитет (включая увеличение продуцирования антигенспецифических CTL) и поэтому имеют особенно важное значение для реагирования на внутриклеточные инфекции. Активированные ТН1 клетки могут секретировать один или несколько IL-2, IFN-γ и TNF-β. Иммунная реакция ТН1 может вызвать местные воспалительные реакции в результате активации макрофагов, естественных клеток-киллеров (NK) и цитотоксических CD8 Т-клеток (CTL). Иммунная реакция ТН1 может также усиливать иммунную реакцию, стимулируя рост В- и Т-клеток с IL-12. ТН1-стимулированные В-клетки могут секретировать IgG2a.

Активированные ТН2 клетки усиливают продуцирование антител и поэтому имеют важное значение для реагирования на внеклеточные инфекции. Активированные ТН2 клетки могут секретировать один или несколько IL-4, IL-5, IL-6 и IL-10. Иммунная реакция ТН2 может вызвать продуцирование IgG1, IgE, IgA и В-клеток памяти для обеспечения последующей защиты.

Усиленная иммунная реакция может включать одну или несколько усиленных иммунных реакций ТН1 и иммунную реакцию ТН2.

Иммунная реакция ТН1 может включать увеличение CTL, увеличение цитокинов, ассоциированных с иммунной реакцией ТН1 (таких как IL-2, IFN-γ и TNF-β), увеличение активированных макрофагов, усиление активности естественных клеток-киллеров (NK) или увеличение продуцирования IgG2a. Усиленная иммунная реакция ТН1 предпочтительно включает увеличение продуцирования IgG2a. Иммунная реакция ТН1 может быть вызвана с помощью адъюванта ТН1. Адъювант ТН1 обычно вызывает более высокое продуцирование IgG2a по сравнению с иммунизацией антигеном без адъюванта. Адъюванты ТН1, пригодные для использования в настоящем изобретении, могут включать, например, препараты сапонина, виросомы и вирусоподобные частицы, нетоксичные производные липополисахарида энтеробактерий (LPS), иммуностимулирующие олигонуклеотиды. Иммуностимулирующие олигонуклеотиды, такие как олигонуклеотиды, содержащие фрагмент CpG, являются предпочтительными адъювантами ТН1 для использования в настоящем изобретении.

Иммунная реакция ТН2 может включать увеличение цитокинов, ассоциированных с иммунной реакцией ТН2 (таких как IL-4, IL-5, IL-6 и IL-10), или увеличение продуцирования IgG1, IgE, IgA и В-клеток памяти. Усиленная иммунная реакция ТН2 предпочтительно включает увеличение продуцирования IgG1.

Иммунная реакция ТН2 может быть индуцирована с помощью адъюванта ТН2. Адъювант ТН2 обычно вызывает более высокое продуцирование IgG1 по сравнению с иммунизацией антигеном без адъюванта. Адъюванты ТН2, пригодные для использования в настоящем изобретении, включают, например, композиции, содержащие минералы, масляные эмульсии, ADP-рибозилирующие токсины и их детоксифицированные производные. Композиции, содержащие минералы, такие как соли алюминия, являются предпочтительными адъювантами ТН2 для использования в настоящем изобретении.

Настоящее изобретение предпочтительно относится к композиции, включающей комбинацию адъюванта ТН1 и адъюванта ТН2. Такая композиция вызывает усиленную реакцию ТН1 и ТН2, то есть увеличение продуцирования IgG1 и IgG2a по сравнению с иммунизацией без адъюванта. Композиция, включающая комбинацию адъювантов ТН1 и ТН2, вызывает более сильную иммунную реакцию ТН1 и ТН2 по сравнению с иммунизацией одним адъювантом (то есть по сравнению с иммунизацией только адъювантом ТН1 или иммунизацией только адъювантом ТН2).

Иммунная реакция может представлять собой только иммунную реакцию ТН1 или иммунную реакцию ТН2 либо обе иммунную реакции. Указанная иммунная реакция предпочтительно является более сильной реакцией ТН1 или более сильной реакцией ТН2 либо обеими более сильными иммунными реакциями.

Более сильная иммунная реакция может быть системной иммунной реакцией или иммунной реакцией слизистой оболочки либо обеими иммунными реакциями. Указанная иммунная реакция предпочтительно является более сильной системной иммунной реакцией или более сильной иммунной реакцией слизистой оболочки либо обеими более сильными иммунными реакциями. Иммунная реакция слизистой оболочки предпочтительно является иммунной реакцией ТН2. Иммунная реакция слизистой оболочки предпочтительно включает увеличение продуцирования IgA.

Инфекции H. influenzae могут поражать разные участки тела, поэтому композиции по настоящему изобретению могут быть получены в разных формах. Например, композиции могут быть получены в виде инъецируемых препаратов, представляющих собой жидкие растворы или суспензии. Также могут быть изготовлены твердые формы, пригодные для получения раствора или суспензии в жидких носителях (например, лиофилизированная композиция или композиция, высушенная распылением). Может быть получена композиция для местного применения, например, мазь, крем или порошок. Может быть получена композиция для перорального введения, например, в виде таблетки или капсулы, в виде аэрозоля или сиропа (необязательно ароматизированного). Может быть получена композиция для введения в легкие, например, с помощью ингалятора, содержащего тонкоизмельченный порошок или аэрозоль. Указанная композиция может быть получена в виде анального или вагинального суппозитория. Может быть получена композиция для введения в нос, уши или глаза, например, в виде капель. Композиция может входить в набор, составленный с возможностью восстановления объединенной композиции непосредственно перед введением субъекту. Такие наборы могут включать один или несколько антигенов в жидкой форме и один или несколько лиофилизированных антигенов.

Если в набор входит композиция, предназначенная для приготовления по индивидуальному рецепту (например, при наличии компонента в лиофилизированной форме), набор может включать две ампулы либо один готовый к использованию шприц и одну ампулу, при этом содержимое шприца может быть использовано для реактивации содержимого ампулы перед инъекцией.

Иммуногенные композиции, используемые в качестве вакцин, включают иммунологически эффективное количество антигенов, а также любые другие необходимые компоненты. Термин ”иммунологически эффективное количество” означает, что введение указанного количества субъекту в виде однократной дозы или части многократно используемого количества, оказывает эффективное воздействие в случае лечения или профилактики. Указанное количество изменяется в зависимости от заболевания и физического состояния субъекта, подлежащего лечению, возраста, таксономической группы подлежащего лечению субъекта (например, примат кроме человека, примат и т.д.), способности иммунной системы субъекта синтезировать антитела, степени требуемой защиты, состава вакцины, оценки лечащим врачом медицинской ситуации и других подобных факторов. Предполагается, что указанное количество находится в относительно широком диапазоне, который может быть определен в результате выполнения стандартных экспериментов. Когда композиция включает несколько антигенов, указанные два антигена могут присутствовать в одинаковой дозе или в разных дозах.

Как было указано выше, композиция может включать термозащитный агент, который может быть особенно полезен в композициях с адъювантом (особенно в композициях, содержащих минеральный адъювант, такой как соль алюминия). Как указано в ссылке 72, жидкий термозащитный агент может быть добавлен к жидкой вакцинной композиции для снижения температуры замерзания, например, для снижения температуры замерзания ниже 0°С. Таким образом, композицию можно хранить при температуре ниже 0°С, но выше температуры замерзания во избежание термического разрушения. Термозащитный агент позволяет замораживать композицию, защищая адъюванты в виде минеральных солей от агломерации или осаждения после замораживания и оттаивания, а также может защищать композицию при повышенных температурах, например, выше 40°С. Исходная водная вакцина и жидкий термозащитный агент могут быть смешаны таким образом, чтобы жидкий термозащитный агент составлял 1-80% от объема конечной смеси. Приемлемые термозащитные агенты должны быть безопасны для человека, легко смешиваться и растворяться в воде и не разрушать другие компоненты (например, антиген и адъювант) в композиции. Примеры термозащитных агентов включают глицерин, пропиленгликоль и/или полиэтиленгликоль (PEG). Приемлемые полиэтиленгликоли могут иметь среднюю молекулярную массу в диапазоне 200-20000 Да. В предпочтительном варианте осуществления изобретения средняя молекулярная масса полиэтиленгликоля может быть равна примерно 300 Да (‘PEG-300’).

Композиции по настоящему изобретению могут быть получены путем смешивания (i) водной композиции, включающей два или более (например, 1, 2, 3, 4) антигенов из комбинаций антигенов по настоящему изобретению, с (ii) термозащитным агентом. Затем смесь можно хранить при температуре ниже 0°С, 0-20°С, 20-35°С, 35-55°С или выше. Полученную смесь можно хранить в жидком или замороженном виде. Смесь может быть лиофилизирована. Указанная композиция может быть альтернативно получена путем смешивания (i) высушенной композиции, включающей два или более (например, 1, 2, 3, 4) антигенов из комбинаций антигенов по настоящему изобретению, с (ii) жидкой композицией, включающей термозащитный агент. Таким образом, компонент (ii) может быть использован для восстановления компонента (i).

Способ лечения и введения вакцины

Настоящее изобретение относится к способу возбуждения иммунной реакции у млекопитающего, который включает стадию введения эффективного количества композиции по настоящему изобретению либо одну или несколько стадий введения по меньшей мере одного или нескольких (например, 1, 2, 3, 4, 5, 6, 7, 8, 9 или 10) антигенов по настоящему изобретению. Иммунная реакция предпочтительно является защитной и предполагает образование антител и/или возникновение клеточно-опосредованного иммунитета. Указанный способ может вызвать вторичную иммунную реакцию.

Данное изобретение также относится по меньшей мере к одному или нескольким антигенам по настоящему изобретению, используемым совместно в качестве лекарственного средства для возбуждения иммунной реакции у млекопитающего.

Данное изобретение также относится к использованию по меньшей мере одного или нескольких антигенов по настоящему изобретению для приготовления лекарственного средства, предназначенного для возбуждения иммунной реакции у млекопитающего.

В способах и применениях по настоящему изобретению по меньшей мере один или несколько (например, 1, 2, 3, 4) антигенов по настоящему изобретению могут быть введены одновременно, отдельно или последовательно.

Благодаря возбуждению у млекопитающего иммунной реакции указанными способами такое млекопитающее может быть защищено от инфекции H. influenzae. Настоящее изобретение позволяет эффективно бороться с H. influenzae разных серотипов, но особенно хорошо защищает от заболевания, вызываемого инфицированием нетипируемым штаммом H. influenzae (NTHI). В соответствии с настоящим изобретением инфекция может вызывать заболевание или состояние, выбираемое из отита (включая острый отит), бронхита, конъюнктивита, синусита, инфекции мочевых путей, пневмонии, бактериемии, септического артрита, эпиглоттита, пневмонии, эмпиемы, перикардита, целлюлита, остеомиелита, инфекции нижнего отдела дыхательных путей и менингита. Настоящее изобретение особенно пригодно для лечения или профилактики воспаления среднего уха либо для лечения или профилактики хронических обструктивных заболеваний легких (COPD) благодаря возбуждению иммунной реакции, препятствующей перемещению бактерий по слуховой трубе из горла в среднее ухо, которое бактерии затем колонизируют.

Настоящее изобретение также относится к набору, включающему первый компонент и второй компонент, в котором ни первый компонент, ни второй компонент не являются вышеописанной композицией по настоящему изобретению, которая образуется при объединении первого и второго компонентов. Указанный набор может далее включать третий компонент, такой как инструкции, шприц или другое устройство для доставки, адъювант или фармацевтически приемлемый раствор для приготовления лекарственного средства.

Настоящее изобретение также относится к устройству для доставки, предварительно заполненному иммуногенной композицией по настоящему изобретению.

Млекопитающее предпочтительно является человеком, например, субъектом, подлежащим лечению. Если вакцина предназначена для профилактического применения, человек предпочтительно является ребенком (например, ребенком, начинающим ходить, или ребенком до семи лет) или подростком; если вакцина предназначена для терапевтического применения, человек предпочтительно является подростком или взрослым. Вакцину, предназначенную для детей, можно также вводить взрослым, например, для оценки безопасности, дозировки, иммуногенности и т.д. Млекопитающее (например, человек, в частности, субъект, подлежащий лечению) может быть подвержено риску заболевания или может быть беременной женщиной ('иммунизация матерей').

Одним способом проверки эффективности терапевтического лечения является контролирование инфекции H. influenzae после введения композиций по настоящему изобретению. Одним способом проверки эффективности профилактического лечения является контролирование иммунных реакций во всем организме (в частности, контролирование продуцирования IgG1 и IgG2a) и/или в слизистой оболочке (в частности, контролирование продуцирования IgA) против антигенов в композициях по настоящему изобретению после введения композиции. Иммуногенность композиций по настоящему изобретению можно определить путем введения указанных композиций испытуемым субъектам (например, детям в возрасте 12-16 месяцев или животным моделям, таким как модель с использованием шиншиллы [73]), и последующего определения стандартных параметров, включающих титры ELISA (GMT) IgG. Указанные иммунные реакции обычно определяют примерно через 4 недели после введения композиции и сравнивают со значениями, полученными до введения композиции. При введении более одной дозы композиции может быть произведено несколько определений после введения композиции. Реакции антигенспецифических сывороточных антител обычно определяют после имимунизации и до контрольного заражения, при этом реакции антигенспецифических антител слизистой оболочки определяют после иммунизации и после контрольного заражения.

Другим способом оценки иммуногенности композиций по настоящему изобретению является рекомбинантная экспрессия белков для исследования сыворотки субъекта или секреций слизистой оболочки при помощи иммуноблоттинга и/или микроматриц. Положительная реакция между белком и образцом, полученным у субъекта, показывает, что у субъекта возникла иммунная реакция на рассматриваемый белок. Указанный метод может быть также использован для идентификации иммунодоминантных антигенов и/или эпитопов в антигенах.

Эффективность вакцинных композиций можно также определить in vivo путем исследования иммунизации на животных моделях инфекции H. influenzae, например, с использованием морских свинок, шиншилл или мышей. Одна такая модель описана в ссылке 74.

Другая приемлемая животная модель, используемая для определения in vivo эффективности вакцинных композиций по настоящему изобретению, описана в ссылке 75.

Композиции по настоящему изобретению обычно вводят субъекту методом прямой доставки. Прямая доставка может быть осуществлена при помощи парентеральной инъекции (например, подкожной, внутрибрюшинной, внутривенной, внутримышечной или в интерстициальное пространство ткани) или введения в слизистую оболочку, такого как ректальное, пероральное (например, таблетка, аэрозоль), вагинальное, местное, чрескожное введение, введение в нос, глаза, уши, легкое или другие слизистые оболочки.

Настоящее изобретение может быть использовано для достижения системного иммунитета и/или иммунитета слизистой оболочки, предпочтительно для достижения более сильного системного иммунитета и/или иммунитета слизистой оболочки.

Более сильный системный иммунитет и/или иммунитет слизистой оболочки находит отражение в более сильной иммунной реакции ТН1 и/или ТН2. Более сильная иммунная реакция включает увеличение продуцирования IgG1, IgG2a и/или IgA.

Схема иммунизации может включать однократное или многократное введение дозы. Многократное введение производят в соответствии со схемой первичной иммунизации и/или повторной иммунизации. В схеме многократного введения разные дозы могут быть введены одинаковыми или разными способами, например, первичная иммунизация может быть произведена путем парентерального введения и повторная иммунизация может быть произведена путем введения в слизистую оболочку, либо первичная иммунизация может быть произведена путем введения в слизистую оболочку и повторная иммунизация может быть произведена путем парентерального введения и т.д. В соответствии со схемой многократного введения дозы вводят с промежутком, равным по меньшей мере 1 недели (например, примерно через 2 недели, примерно через 3 недели, примерно через 4 недели, примерно через 6 недель, примерно через 8 недель, примерно через 10 недель, примерно через 12 недель, примерно через 16 недель и т.д.).

Вакцины, полученные по настоящему изобретению, могут быть использованы для лечения детей и взрослых. Таким образом, возраст субъекта может быть меньше 1 года, 1-5 лет, 5-15 лет, 15-55 лет или по меньшей мере 55 лет. Предпочтительными субъектами для введения вакцин являются пожилые люди (например, ≥50 лет, ≥60 лет и предпочтительно ≥65 лет), дети (например, ≤5 лет), госпитализированные субъекты, работники здравоохранения, военнослужащие и обслуживающий персонал, беременные женщины, хронически больные субъекты или субъекты с иммунодефицитом. Однако вакцины предназначены не только для указанных групп населения и могут быть использованы для имммунизации всего населения.

Вакцины, полученные по настоящему изобретению, могут быть введены субъектам по существу одновременно (например, во время медицинского обследования, посещения лечебного учреждения или центра вакцинации) с другими вакцинами, например, по существу одновременно с вакциной против кори, вакциной против паротита, вакциной против краснухи, вакциной против MMR, вакциной против ветряной оспы, вакциной против MMRV, вакциной против дифтерии, протитвостолбнячной вакциной, коклюшной вакциной, вакций против DTP, конъюгированной вакциной против H. influenzae типа b, инактивированной полиомиелитной вакциной, коъюгатной менингококковой вакциной (такой как четырехвалентная вакцина A-C-W135-Y), вакциной против респираторно-синцитиального вируса и т.д.

Иммунизация слизистой оболочки

Настоящее изобретение относится к антигенам, комбинациям антигенов и композициям для иммунизации слизистой оболочки. Например, настоящее изобретение относится к иммуногенной композиции, включающей (i) комбинацию полипептидных антигенов по настоящему изобретению и (ii) бактериальный ADP-рибозилирующий токсин и/или его детоксифицированное производное. Настоящее изобретение также относится к способу усиления иммунной реакции у млекопитающего, который включает стадию введения млекопитающему эффективного количества такой иммуногенной композиции. Указанную композицию предпочтительно вводят через слизистую оболочку (на поверхность слизистой оболочки), например, композиция может быть введена в нос.

Токсин компонента (ii) может быть выделен из теплолабильного энтеротоксина (“LT”) E. coli. Указанное производное может иметь детоксифицирующую мутацию в субъединице А, например, такая мутация может включать LT-K63 или LT-R72. Такая мутация, в частности, может представлять собой LT-K63. В других вариантах осуществления изобретения указанная мутация не является мутацией LT-K63.

Предпочтительным является назальное введение антигенов или композиций по настоящему изобретению и адъюванта LT-K63. Такое введение может уменьшить бактериальную нагрузку H. influenzae в носоглотке, легких и крови и увеличить коэффициент выживаемости инфицированных млекопитающих.

Другие антигенные компоненты композиций по настоящему изобретению

Настоящее изобретение также относится к композициям, включающим по меньшей мере еще один антиген нетипируемого штамма H. influenzae.

Настоящее изобретение также относится к композициям, включающим по меньшей мере еще один антиген, не являющийся антигеном нетипируемого штамма H. influenzae.

В частности, настоящее изобретение также относится к композиции, включающей один или несколько полипептидов по настоящему изобретению и один или несколько следующих дополнительных антигенов:

- антиген из серогруппы N. meningitidis A, B, C, W135 и/или Y;

- сахаридный или полипептидный антиген из Streptococcus pneumoniae [например, ссылки 76, 77, 78];

- антиген из вируса гепатита А, в частности, инактивированного вируса [например, ссылки 79, 80];

- антиген из вируса гепатита В, в частности, поверхностный и/или ядерный антиген [например, ссылки 80, 81];

- дифтерийный антиген, в частности, дифтерийный токсоид [например, глава 3 ссылки 82] или мутант CRM197 [например, ссылка 83];

- столбнячный антиген, в частности, столбнячный токсоид [например, глава 4 ссылки 82];

- антиген из Bordetella pertussis, в частности, коклюшный голотоксин (РТ) и нитчатый гемагглютинин (FHA) из B. pertussis, необязательно также в комбинации с пертактином и/или агглютиногенами 2 и 3 [например, ссылки 84 и 85];

- полноклеточный коклюшный антиген;

- сахаридный антиген из Haemophilus influenzae B [например, ссылка 86];

- полиомиелитный антиген [например, ссылки 87, 88], такой как IPV;

- антигены кори, пароцита и/или краснухи [например, главы 9, 10 и 11 ссылки 82];

- антиген гриппа [например, глава 19 ссылки 82], в частности, поверхностные белки гемагглютинина и/или нейраминидазы;

- антиген из Moraxella catarrhalis [например, ссылка 89];

- белковый антиген из Streptococcus agalactiae (стрептококк группы В) [например, ссылки 90, 91];

- сахаридный антиген из Streptococcus agalactiae (стрептококк группы В);

- антиген из Streptococcus pyogenes (стрептококк группы А) [например, ссылки 91, 92, 93];

- антиген из Staphylococcus aureus [например, ссылка 94];

- антиген из респираторно-синцитиального вируса, например, рекомбинантный белок F [например, ссылка 142];

- вакцинная композиция, включающая конъюгатную вакцину (адсорбированную) против дифтерии (D), столбняка (Т), коклюша (бесклеточный компонент) (Ра), гепатита В (рДНК) (HBV), полиомиелита (инактивированный) (IPV) и Haemophilus influenzae типа b (Hib), например, Infantrix-hexa.

Композиция может включать один или несколько указанных дополнительных антигенов. Комбинации с вакциной против RSV и/или c DTPa-содержащей вакциной являются особенно интересными.

Токсичные белковые антигены при необходимости могут быть детоксифицированы (например, детоксификация коклюшного токсина химическими и/или генетическими средствами [ссылка 85]).

При введении в композицию дифтерийного антигена желательно также включить в указанную композицию столбнячный антиген и коклюшный антиген. Аналогичным образом, при введении коклюшного антигена, желательно также включать дифтерийный и столбнячный антигены. Такие образом, предпочтительными являются комбинации DTP.

Сахаридные антигены предпочтительно используют в форме конъюгатов. Белки-носители для конъюгатов включают дифтерийный токсин, столбнячный токсин, белок наружной мембраны N. meningitidis [95], синтетические пептиды [96, 97], хитшоковые белки [98, 99], коклюшные белки [100, 101], протеин D из H.influenzae [102], цитокины [103], лимфокины [103], стрептококковые белки, гормоны [103], факторы роста [103], токсин А или В из C.difficile [104], железопоглощающие белки [105] и т.д. Предпочтительным белком-носителем является мутант CRM197 дифтерийного токсина [106].

Антигены обычно присутствуют в указанных композициях в концентрации, равной по меньшей мере 1 мкг/мл каждого антигена. Как правило, концентрация любого данного антигена должна быть достаточной для возбуждения иммунной реакции против данного антигена.

В качестве альтернативы использованию белковых антигенов в иммуногенных композициях по настоящему изобретению может быть использована нуклеиновая кислота (предпочтительно ДНК в форме плазмиды), кодирующая данный антиген.

Антигены предпочтительно адсорбируют на соли алюминия.

Антитела

Антитела против антигенов по настоящему изобретению могут быть использованы для пассивной иммунизации [107]. Таким образом, настоящее изобретение относится к антителам, специфичным к антигенам по настоящему изобретению, которые предназначены для использования в терапии. Указанные антитела могут быть использованы отдельно или в комбинации. Настоящее изобретение также относится к иммуногенным и фармацевтическим композициям, включающим такие антитела.

Антитела могут быть использованы в медицине и терапии, например, для пассивной иммунизации против NTHI или для уничтожения инфекции NTHI. Настоящее изобретение также относится к использованию таких антител в приготовлении лекарственного средства. Настоящее изобретение также относится к способу лечению млекопитающего, который включает стадию введения эффективного количества антитела по настоящему изобретению. Как было указано выше для иммуногенных композиций, указанные способы и применения позволяют защитить млекопитающего от инфекций NTHI. В частности, антитела по настоящему изобретению могут быть использованы в способах лечения или профилактики инфекций, вызываемых NTHI, которые включают стадию введения млекопитающему эффективного количества антитела по настоящему изобретению или композиции, включающей такое антитело.

Термин ”антитело” означает интактную молекулу иммуноглобулина (такую как паливизумаб) и ее фрагменты, способные связываться с антигеном NTHI. Указанные молекулы включают гибридные (химерные) антитела [108, 109], F(ab’)2 и F(ab) фрагменты и Fv молекулы, нековалентно связанные гетеродимеры [110, 111], одноцепочечные Fv молекулы (sFv) [112], димерные и тримерные конструкции фрагментов антител, минитела [113, 114], гуманизированные антитела [115-117] и любые функциональные фрагменты, полученные из таких молекул, а также антитела, полученные нестандартными методами, такими как отображение на фаге. Антитела предпочтительно являются моноклональными антителами. Методы получения моноклональных антител хорошо известны в данной области. Предпочтительными являются гуманизированные или полностью человеческие антитела. Антитела и комбинации антител по настоящему изобретению могут быть очищены или выделены.

Общая часть

При осуществлении настоящего изобретения использованы, за исключением особо оговоренных случаев, стандартные методы, применяемые в химии, биохимии, молекулярной биологии, иммунологии и фармакологии и хорошо известные в данной области. Такие методы всесторонне описаны в научной литературе. См., например, ссылки 118-125 и т.д.

Применительно к настоящему изобретению термин “эпитоп” означает В-клеточный эпитоп и/или Т-клеточный эпитоп. Такие эпитопы могут быть идентифицированы эмпирически (например, с помощью метода PEPSCAN [126, 127] или подобных методов) или прогнозированы (например, при помощи антигенного индекса Джеймсона-Вульфа [128], матричных методов [129], MAPITOPE [130], TEPITOPE [131, 132], невральных сетей [133], OptiMer & Epimer [134, 135], ADEPT [136], Tsites [137], гидрофильности [138], антигенного индекса [139] или методов, описанных в ссылках 140-144, и т.д.). Эпитопы являются частями антигена, узнаваемыми антителами и связывающимися с антигенсвязывающими центрами антител или Т-клеточными рецепторами, которые могут быть также определены как “антигенные детерминанты”.

Отсутствие ”домена” антигена может означать отсутствие сигнального пептида, цитоплазматического домена, трансмембранного домена, внеклеточного домена и т.д.

Термин ”включающий” также имеет значение “состоящий из”, например, композиция, ”включающая” Х, может состоять исключительно из компонентов Х или может включать некоторые дополнительные компоненты, например Х+Y.

Термин ”примерно” применительно к числовому значению х является необязательным и означает, например, х±10%.

Ссылка на процентное значение идентичности аминокислотных последовательностей означает, что при выполнении сравнительного анализа процентное значение аминокислот является одинаковым в двух сравниваемых последовательностях. Выполнить сравнительный анализ, определить процентное значение гомологии или идентичности последовательностей можно при помощи программного обеспечения, известного в данной области, которое описано, например, в разделе 7.7.18 ссылки 22. Предпочтительный сравнительный анализ выполняют при помощи алгоритма поиска гомологии Смита-Ватермана с выявлением разрывов при штрафе за открытый разрыв 12 и штрафе за удлинение разрыва 2, матрицы BLOSUM 62. Алгоритм поиска гомологии Смита-Ватермана описан в ссылке 145.

Краткое описание чертежей

На фигуре 1 показана минииндукция, подтверждающая сильную экспрессию антигенов в клетках BL21 (DE3)T1r. (LMWM: стандартные маркеры молекулярной массы).

На фигуре 2 показаны разные результаты для NT001, NT007, NT018, NT024, NT032 и NT067. Аналогичные результаты экспрессии были получены для других предпочтительных антигенов, таких как NT052, NT004, NT014, NT016 или NT022. В каждом блоке представлены данные вестерн-блоттинга и данные FACS. Вестерн-блоты были получены с использованием мышиной сыворотки, полосы показывают взаимодействие с полными бактериальными экстрактами (“ТЕ”), пузырьками, полученными из наружных мембран NTHI (“OMV”), или очищенным рекомбинантным белком (“РР”). Анализы FACS выполняют после инкубации инактивированных бактерий с сывороткой мышей, иммунизированных разными антигенными композициями, с использованием только квасцов в качестве отрицательного контрольного образца; отрицательные контрольные образцы сыворотки, полученной до иммунизации, показаны в виде закрашенных участков, и сигнал экспрессии на поверхности экспериментальной сыворотки, показан одной линией.

На фигуре 3 схематически изображен 96-луночный планшет, использованный при выполнении бактерицидного анализа сыворотки для проверки способности антисыворотки против антигенов по настоящему изобретению уничтожать NTHI.

Варианты осуществления изобретения

Общий обзор

Все антигены, которые были признаны консервативными в результате выполнения сравнительного анализа по меньшей мере 86 разных штаммов NTHI, были клонированы и экспрессированы. Белки очищали и использовали для иммунизации мышей. Антисыворотку иммунизированных мышей использовали для проверки поверхностной локализации и защитных способностей белков, использованных для иммунизации (таблица III и/или таблица IV). Полученные результаты показывают, что иммунизация антигенами NT052, NT024, NT032, NT001, NT067, NT004, NT014, NT022, NT016 хорошо защищает от NTHI, при этом была обнаружена более высокая или по меньшей мере сравнимая активность в отношении уничтожения бактерий при выполнении бактерицидного анализа сыворотки (SBA) даже при сравнении со ”второй группой антигенов”.

Штаммы и варианты

Было установлено, что гены, кодирующие антигены NT022, NT016, NT014, NT018, NT024, NT032, NT067 и NT001, присутствуют во всех 86 анализированных геномных последовательностях и являются консервативными.

Кодированные последовательности антигена NT018 были на 95-100% идентичны панели, состоящей из 15 полных геномов и 32 штаммов из финской коллекции отита. Кодированные последовательности антигена NT024 были на 90-100% идентичны панели, состоящей из 15 полных геномов и 32 штаммов из финской коллекции отита.

Кодированные последовательности антигена NT032 были на 95-100% идентичны панели, состоящей из 15 полных геномов и 32 штаммов из финской коллекции отита; кодированные последовательности антигена NT067 были на 95-100% идентичны панели, состоящей из 15 полных геномов и 32 штаммов из финской коллекции отита. Кодированные последовательности антигена NT001 были на 95-100% идентичны панели, состоящей из 15 полных геномов и 32 штаммов из финской коллекции отита.

Консерватизм кодированных аминокислотных последовательностей показан в таблице I.

Таблица I
Консерватизм антигенов (% идентичности) в геномах и штаммах Haenophilus
Антиген NT018 NT024 NT032 NT067 NT001
% 95-100 90-100 95-100 95-100 95-100

В соответствии с целями экспрессии антигены, относящиеся к ”первой группе антигенов” и/или ”второй группе антигенов”, были клонированы в штамме Fi176, предоставленном финской коллекцией штаммов, полученных у субъектов, страдающих отитом, или в штамме R2846 [146]. Большинство отобранных антигенов, которые были испытаны в животной модели, также являются консервативными в таких штаммах как, например, NT016, NT067, NT022, NT014.

В некоторых случаях в последовательности дикого типа были введены мутации. Указанные мутации подчеркнуты в последовательностях, приведенных для антигенов NT018, NT067, NT001, NT016, NT002, NT026, NT009, NT015, NT023 и NT066 (см. SEQ ID NO:49, 52, 54, 55, 57-59, 64, 65 и 67).

Клонирование и экспрессия рекомбинантных белков NTHI

Антигены могут быть клонированы и экспрессированы стандартными методами [121].

Открытые рамки считывания (ORF) для штамма NTHI Fi176 или R2846 амплифицировали методом ПЦР, используя специфические олигонуклеотиды и хромосомную ДНК NTHI в качестве матрицы. Полученные продукты ПЦР клонировали в pET15b (Novagen) методом PIPE [147], который включает амплификацию методом ПЦР клонирующего вектора (V-PCR) и амплификацию методом ПЦР вставки (I-PCR). Затем 1 мкл V-PCR и 1 мкл I-PCR смешивали и переносили в химически компетентные клетки НК100 [148]. Реакции I-PCR выполняли, используя 1 мкМ верхних и нижних затравок, однократный буфер для взаимодействия с ДНК-полимеразой Pfu, 2,5 ед. ДНК-полимеразы Pfu Turbo (Stratagene), 200 мкМ каждого dNTP (Invitrogen) и 50 нг геномной матричной ДНК. Реакции выполняли следующим образом: первичная денатурация в течение 2 минут при 95°С, затем 25 циклов при 95°С в течение 30 секунд, при 55°С в течение 45 секунд и при 68°С в течение 3 минут и последующее конечное охлаждение до 4°С. Реакции V-PCR были идентичны реакциям I-PCR, но стадии при 68°С продолжались 14 минут и в качестве матричной ДНК было использовано 2 нг плазмиды pET15b. Правильные трансформанты были отобраны путем скрининга методом ПЦР и секвенирования плазмидной ДНК в области соединения вектора - вставки. Из отобранных клонов НК100 была получена правильная плазмида, которую использовали для трансформации клеток BL21(DE3)T1r (Sigma) с целью экспрессии белка.

Для экспрессии клонированных белков клоны BL21(DE3)T11, содержащие конструкции pET15b, выращивали в среде LB, содержащей 100 мкг/мл ампициллина, при 37°С до достижения OD600=0,5. Экспрессию белка индуцировали, добавляя 1 мМ IPTG и выращивая при той же температуре в течение еще 3 часов. Белок экстрагировали стандартными методами и анализировали методом DSD-PAGE для проверки экспрессии белка. На фигуре 1 показана минииндукция, подтверждающая хорошую экспрессию антигенов.

Очистка белков

Белки очищали следующим методом: сырую биомассу BL21(DE3)T1 суспендировали в лизирующем буфере и очищали центрифугированием. Для очистки растворимого белка супернатанты после лизиса наносили на высокопроизводительные 96-луночные планшеты, содержащие 50 мкл Ni-сефарозы с меткой His, Multitrap HP. Для очистки нерастворимого белка (HtrA, PE и Р48) гранулы, содержащие нерастворимую фракцию, после лизиса солюбилизировали в 6 М растворе гуанидингидрохлорида и супернатанты наносили на высокопроизводительные 96-луночные планшеты, содержащие 50 мл Ni-сефарозы с меткой His, Multitrap HP.

Выходящий поток собирали и все лунки промывали буфером, содержащим 20 мМ имидазола. Белки, гибридизированные с меткой His, элюировали 250 мМ имидазола. Указанную процедуру выполняли в вакуумной системе. Очищенные антигены использовали в схемах иммунизации по настоящему изобретению.

Очистку выполняли в соответствии со следующим протоколом:

1) Гранулу BL21(DE3)T1 (1 г) ресуспендируют в 1,5 мл буфера B-PER™ (PIERCE), добавляют 15 мкл лизоцима, 7,5 мкл ДНКазы и 3 мкл 1 М раствора MgCl2

2) Инкубируют в течение 30 минут для лизиса

3) Центрифугируют со скоростью 20000 об./мин при 4°С в течение 30 минут; для очистки любого нераствормого белка гранулы, содержащие нерастворимую фракцию после лизиса, солюбилизируют 6 М раствором гуанидингидрохлорида и повторно центрифугируют

4) Супернатант выделяют и фильтруют (поры 0,8 мкм)

5) Используют высокопроизводительный 96-луночный планшет, содержащий 50 мкл Ni-сефарозы с меткой His, Multitrap HP, соединенный с вакуумной системой.

Буфер А: 50 мМ NaPPi, 300 мМ NaCl, рН8.

Буфер В: 50 мМ NaPPi, 300 мМ NaCl, 250 мМ имидазола, рН8.

Буфер С: 50 мМ NaPPi, 300 мМ NaCl, 20 мМ имидазола, рН8.

1-я стадия: удаление этанола с планшета.

2-я стадия: промывка планшета 400 мкл Н2О milliQ.

3-я стадия: уравновешивание планшета 400 мкл буфера А.

4-я стадия: введение 600 мкл исходного вещества для каждого белка в одну из 12 колонок. Если объем исходного вещества больше объема колонки, процедуру повторяют, пока все вещество не будет введено в колонку.

Сбор вытекающего потока.

5-я стадия: стадия промывки: 4 промывки 400 мкл буфера С. Удаление вытекающего потока.

6-я стадия: элюирование: 2 × 300 мкл буфера В (2 стадии элюирования).

Создание вакуума в течение 15 минут после добавления буфера.

1 мкл полного экстракта, 1 мкл исходного вещества, 1 мкл вытекающего потока и 10 мкл элюируемого объема (для каждого белка) анализируют методом SDS-PAGE.

Для нерастворимого белка буфер В заменяют 10 мМ трис-буфера, 50 мМ Na2HPO4, 8 М раствором мочевины, 250 мМ имидазола, 40% глицерина.

Испытание LAL

Испытание LAL позволяет измерять концентрацию эндотоксина в образце вакцины при помощи метода endosafe®-PTS™ Charles River.

Методика испытания

В методе PTS использована хромогенная кинетика LAL для измерения интенсивности цвета, которая непосредственно связана с концентрацией эндотоксина в образце. Каждый картридж содержит точное количество лицензированного реагента LAL, хромогенного субстрата и контрольного стандартного эндотоксина (CSE). Картриджи изготавливают при строгом контроле качества для гарантии точности испытания и устойчивости продукта.

Таблица II
Очистка предпочтительных антигенов
Идентификатор Аннотация кДа (ожидаемая масса) кДа (масса, измеренная методом SE) Растворимый белок % чистоты Испытание LAL эндотоксиновые ед./мкг
денситометрия обращенная ВЭЖХ вытеснительная ГЖХ вытеснительная ВЭЖХ
nt001 NTHI0877 30 36 да 97 84 мономер 0,47
nt018 NTHI0915 34 46 да 80 88 мономер 0,18
nt024 NTHI1416 20 20 да 81 85 97 мономер 3,77
nt032 NTHI2017 13 16 да 91 76 мономер 0,82
nt067 NTHI1292 60 50 да 88 78 мономер 0,06
nt052 CGSHiGG_00130 34 46 да 88 88 мономер 0,18
nt004 CGSHiGG_08215 20 34 да 95 95 мономер 0,09
nt014 HI1658 20 17 да 89 87 мономер 0,10
nt022 NTHI0830 43 77 да 93 93 мономер 0,10

nt016 NTHI0266 29 30 да 98% мономер 0,13

Иммунизация мышей и продуцирование антисыворотки

Мышей CD1 в возрасте пяти недель (8 для каждого антигена) иммунизировали 10 микрограммами очищенных белковых антигенов с адъювантом Фрейнда (200 микролитров/мышь) или с квасцами (адъювант на основе гидроксида алюминия, 2 мг/мл), выполняя 3 внутрибрюшинные инъекции (через каждые две недели). Сыворотку собирали через две недели после третьей инъекции и хранили при -20°С. Контрольным мышам инъецировали только адъювант Фрейнда или только квасцы.

Анализ FACS

Анализ методом FACS с поверхностным мечением выполняли для определения экспонирования отобранных антигенов на поверхности и уровней экспрессии в разных штаммах. NTHI инкубировали с сывороткой, полученной у мышей, иммунизированных рекомбинантными белками, или с отрицательными контрольными образцами сыворотки, и анализировали методом FACS. Полученные результаты приведены на фигуре 2. На фигуре 2 отрицательные контрольные образцы сыворотки до иммунизации показаны в виде закрашенных участков, и сигнал экспериментальной сыворотки показан одной линией. Результаты анализов FACS антигенов Р48, HtrA, РЕ и Р26 показывают, что каждый из указанных антигенов экспонирован на поверхности бактерии и, следовательно, доступен для связывания антителом.

При выполнении указанного анализа были использованы следующие материалы и методы.

Материалы

1. 96-луночные планшеты с U-образными лунками.

2. Блокирующий и промывочный буфер: PBS, содержащий 1% (мас./об.) BSA.

3. Антитело козы против IgG мыши, меченное флуоресцинизотиоцианатом (FITC).

4. PBS, содержащий 0,5% (об./об.) параформальдегида: исходный раствор разводят 4% (об./об.) параформальдегида в PBS до 0,5% (об./об.) непосредственно перед выполнением анализа и стерилизуют фильтрацией (0,22 мкм фильтр).

5. PBS, содержащий 1% (мас./об.) BSA. Для получения указанного раствора 1% (мас./об.) BSA растворяют в PBS, получая по меньшей мере 100 мл для каждого штамма. Раствор стерилизуют фильтрацией (0,22 мкм фильтр) и получают непосредственно перед использованием.

6. Пробирки для анализа FACS (FACScan, Becton Dickson).

7. Проточный цитометр для анализа FACS (FACScalibur, Becton Dickson).

Методы

1. NTHI выращивают до достижения значения ODλ600, равного 0,5, затем 1 мл культуры переносят в стерильную 1,5 мл пробирку Eppendorf и центрифугируют с ускорением 13000g в микроцентрифуге в течение 3 минут для осаждения бактерий. Супернатант удаляют и осадок суспендируют в 1 мл PBS, содержащем 1% (мас./об.) BSA. И наконец, бактериальную суспензию разводят в отношении 1/50 в PBS, содержащем 1% (мас./об.) BSA.

2. 50 мкл образцы сыворотки, разведенной в блокирующем буфере (в отношении 1/100, 1/200 и 1/400), переносят на 96-луночный планшет. Вводят положительные контрольные образцы, такие как антисыворотка против OMV.

3. В каждую лунку добавляют 50 мкл бактериальных клеток и выдерживают планшет при 4°С в течение 2 часов.

4. Клетки центрифугируют в течение 5 минут с ускорением 3500 g, удаляют супернатант и промывают клетки, добавляя 200 мкл/лунку промывочного буфера.

5. В каждую лунку добавляют 50 мкл FITC-конъюгированного антитела козы против Ig мыши, разведенного в отношении 1/100, и выдерживают планшет при 4°С в течение 1 часа.

6. Клетки центрифугируют с ускорением 3500 g в течение 5 минут и промывают осадок 200 мкл/лунку PBS.

7. Повторяют стадию центрифугирования, удаляют супернатант и добавляют 200 мкл/лунку PBS, содержащего 0,5% (об./об.) параформальдегида для фиксации клеток.

8. Фиксированные образцы переносят в отдельные пробирки FACScan и анализируют при помощи проточной цитометрии в соответствии с инструкциями производителя оборудования.

Бактерицидный анализ сыворотки (SBA)

Антисыворотку, полученную у мышей, иммунизированных рекомбинантными белками, испытывали, выполняя бактерицидный анализ сыворотки, для проверки наличия функциональных антител, способных индуцировать уничтожение NTHI. Сыворотку, полученную до иммунизации, и сыворотку, полученную у мышей, которым инъецировали только адъювант, использовали в качестве отрицательных контрольных образцов. Культуру NTHI (штамм 176) (BHI+NAD и гемин) инкубировали, встряхивая, при 37°С до достижения значения OD595, равного 0,25-0,27. Бактериальные клетки разводили в буфере D-PBS в отношении 1:50000. Сыворотку инактивировали при 56°С в течение 30 минут и затем серийно разводили в D-PBS на 96-луночном планшете с U-образными лунками (см. фигуру 3). В вертикальных рядах 11 и 12 планшета, показанного на фигуре 3, находятся отрицательные контрольные образцы, использованные для оценки роста бактерий и обнаружения любого не опосредованного комплементом уничтожения бактерий. Бактерии и источник комплемента (Rabbit 7504, Cedarlane) добавляли в каждую лунку за исключением лунок с контрольными образцами комплемента, в которые вводили термоинактивированный комплемент.

Как показано на фигуре 3, лунки в вертикальных рядах 1-10 содержат 25 мкл разведенной сыворотки, 12,5 мкл активного комплемента и 12,5 мкл бактерий. Лунки в 11-м вертикальном ряду содержат 25 мкл буфера, 12,5 мкл активного комплемента и 12,5 мкл бактерий. Лунки в 12-м вертикальном ряду содержат 25 мкл буфера, 5 мкл сыворотки, 12,5 мкл термоинактивированного комплемента и 12,5 мкл бактерий.

Для выполнения анализа 10 мкл контрольных образцов (вертикальные ряды 11-12) высевали в нулевой период времени (Т0) на агаровую пластинку с шоколадом (Biomerieux) методом нанесения пятна и наклона. Планшеты инкубировали при 37°С. Аналитические титрационные микропланшеты инкубировали в течение 1 часа при 37°С. По истечении указанного периода (Т60) 7 мкл культуры из каждой лунки наносили в виде пятна на агаровую пластинку с шоколадом (культуру из каждой лунки высевали в двух копиях). Число колоний (колониеобразующие единицы, CFU) подсчитывали при помощи счетчика колоний или вручную. Бактерицидный эффект считался обоснованным при уменьшении числа колоний на 50% по сравнению с периодом времени Т=0.

Обзор полученных результатов представлен в таблице III и таблице IV, приведенных ниже.

Таблица III
Результаты иммуногенности
Внутренний идентификатор Аннотация SEQ ID NO: кДа Титры SBA с адъювантом Фрейнда (176wt) FACS
NT001 NTHI0877 SEQ ID NO: 6 или SEQ ID NO: 54 30 2048-8192 +++++
NT016 NTHI0266 SEQ ID NO: 7 или SEQ ID NO: 55 29 2048-8192 +++++
NT024 NTHI1416 SEQ ID NO: 2 или SEQ ID NO: 50 20 2048-8192 ++
NT032 NTHI2017 SEQ ID NO: 3 или SEQ ID NO: 51 13 2048-8192 +
NT018 NTHI0915 SEQ ID NO: 1 или SEQ ID NO: 49 34 2048-4096 +
NT038 CGSHiGG_02400 SEQ ID NO: 4 или SEQ ID NO: 50 22 2048-4096 ++
NT052 CGSHiGG_00130 SEQ ID NO: 8 или SEQ ID NO: 56 44 2048-4096 ++

NT067 NTHI1292 SEQ ID NO: 5 или SEQ ID NO: 52 60 2048 ++
NT002 NTHI1627 SEQ ID NO: 9 или SEQ ID NO: 57 18 1024-2048 +++
NT026 NTHI1109 SEQ ID NO: 10 или SEQ IDNO: 58 19 4096-8192 ++++
NT009 NTHI0821 SEQ ID NO: 11 или SEQ ID NO:59 64 4096 +++
NT025 NTHI0409 SEQ ID NO: 12 или SEQ ID NO: 60 17 4096 ++++
NT028 NTHI1954 SEQ ID NO: 13
SEQ ID NO: 61
20 4096 +++
NT029 NTHI0371 SEQ ID NO: 14 SEQ ID NO: 62 101 4096 +++
NT031 NTHI0509 SEQ ID NO: 15
SEQ ID NO: 63
20 4096 +
NT015 NTHI0449 SEQ ID NO: 16 SEQ ID NO: 64 15 2048-4096 ++
NT023 NTHI1473 SEQ ID NO: 17 SEQ ID NO: 65 17 2048-4096 ++
NT100 gi145633184 SEQ ID NO: 18 SEQ ID NO: 66 34 2048-4096 +
NT040 NTHI1110 SEQ ID NO: 19 26 1024-2048 +
NT048 gi-46129075 SEQ ID NO: 20 71 1024-2048 +
NT053 gi145628236 SEQ ID NO: 21 17 1024-2048 +
NT066 NTHI1230 SEQ ID NO: 22 SEQ ID NO: 67 59 1024-2048 +
NT097 NTHI0522 SEQ ID NO: 23 50 1024-2048 ++
NT006 (HtrA) NTHI1905 SEQ ID NO: 25 51 2048 ++++

NT035 (PE) NTHI0267 SEQ ID NO: 26 18 512-1024 ++
NT080 (PHiD) NTHI0811 SEQ ID NO: 28 512
NT081(P6) NTHI0501 SEQ ID NO: 29 512
NT010 (P26) NTHI1083 SEQ ID NO: 27 22 128-512 +++
NT007 (P48) NTHI0254 SEQ ID NO: 24 48 8192-16384 +++++
Неродственный антиген 16 +
Только адъювант Фрейнда 512/1024

Полученные результаты показывают, что отобранные антигены эффективно уничтожают патогенные микроорганизмы NTHI. В частности, антигены NT018, NT001, NT024, NT032, NT067, NT016 демонстрируют особенно сильное защитное действие.

Таблица IV
Эксперименты по иммунизации с использованием композиций, включающих антигены NTHI и квасцы
Белковый антиген Чистота SBA (адъювант Фрейнда) SBA (квасцы) FACS (адъювант Фрейнда) FACS (квасцы) Растворимость
NT001 97% 2048-8192 512-1024 +++++ +++ Да
NT024 94% 2048-8192 1024 ++ +++ Да
NT038 97% 2048-4096 64 ++ - Да
NT018 80% 2048-4096 512-1024 + +++ Да
NT032 99% 2048-8192 64-128 + + Да
NT067 88% 2048 512-2048 ++ +++ Да
NT025 94% 4096 128-256 ++++ + Нет

NT026 64% 4096-8192 64 ++++ - Нет
NT028 81% 4096 128-256 +++ ++ Нет
NT029 52% 4096 128 +++ ++ Да
NT023 80% 2048-4096 256-512 ++ + Да
NT015 78% 2048-4096 128-256 ++ + Нет
NT031 90% 4096 128 + + Нет
NT100 81% 2048-4096 512 + + Да
NT081 (P6) 88% 2048 256 + + Нет
NT080 (PHiD) 92% 1024 128 + +
NT006 (HtrA) 57% 2048 256 ++++ ++++
NT007 (P48) 79% 8192-16384 256-512 +++++ +++++
NT052 88% 2048-4096 512-1024 + +++ Да
NT014 87% 1024 512-1024 ++ ++ Да
NT004 95% 256-512 128-256 ++ + Да
NT022 93% 64-256 1024 +++ + Да
NT016 98% 2048-8192 128 +++ ++++ Да
NT106 82% Не испытывался 64-128 ++ +++ Да
NT113 92% Не испытывался 128 ++ +++ Да
NT061 83% Не испытывался 128 +++ +++ Да
Адъювант Фрейнда 512 Данные отсутствуют
Квасцы Данные отсутствуют 4-8

Полученные результаты далее подтверждают, что отобранные антигены эффективно уничтожают патогенные микроорганизмы NTHI при использовании в иммуногенных композициях, содержащих квасцы в качестве адъюванта.

В частности, антигены NT016, NT052, NT018, NT001, NT024, NT032, NT067, NT014, NT022 демонстрируют такое же сильное защитное действие, как и измеренное при выполнении бактерицидного анализа сыворотки (SBA).

Особенно предпочтительными антигенами являются NT067, NT014, NT016, NT022. Указанные антигены были также испытаны в животной модели in vivo в соответствии с протоколом, описанным в ссылке 75.

Испытание эффективности вакцины in vivo

Отдельные антигены, представленные в таблице IV, могут быть испытаны в отношении их способности защищать от инфицирования отитом (ОМ) в модели in vivo, такой как мыши-мутанты Junbo и Jeff [75].

Эффективность вакцины в эксперименте по защите in vivo определяют при трехкратном введении (в 0-й, 21-й, 35-й день) 10 микрограммов/мышь очищенных рекомбинантных белковых антигенов с адъювантом или без него с последующей назальной инокуляцией отобранных патогенных штаммов NTHI.

Сыворотку, полученную до иммунизации, сыворотку, полученную после иммунизации, и последнюю сыворотку, полученную через 7 дней после инокуляции NTHI, собирали и хранили при -80°С. Контрольных мышей иммунизировали адъювантом или неродственным антигеном в качестве контрольного антигена. Образцы промывки среднего уха и носоглотки собирали и высевали для определения числа NTHI; затем вычисляли скорости переноса инфекции в среднее ухо и носоглотку и определяли титры NTHI в среднем ухе.

Следует отметить, что в настоящее изобретение, описанное выше на основании примеров, могут быть внесены модификации при сохранении объема и сущности изобретения.

Таблица V
Перекрестная ссылка на номенклатуру типичных штаммов
86028NP Штамм 3655 Штамм PittG
SEQ ID NO: Название № NTHI
1 или 49 NT018 NTHI0915

2 или 50 NT024 NTHI1416
3 или 51 NT032 NTHI2017
4 или 53 NT038 CGSHiGG_02400
5 или 52 NT067 NTHI1292
6 или 54 NT001 NTHI0877
7 или 55 NT016 NTHI0266
8 или 56 NT052 CGSHiGG_00130
9 или 57 NT002 NTHI1627
10 или 58 NT026 NTHI1109
11 или 59 NT009 NTHI0821
12 или 60 NT025 NTHI0409
13 или 61 NT028 NTHI1954
14 или 62 NT029 NTHI0371
15 или 63 NT031 NTHI0509
16 или 64 NT015 NTHI0449
17 или 65 NT023 NTHI1473
18 или 66 NT100 gi-145633184
19 NT040 NTHI1110
20 NT048 gi-46129075
21 NT053 gi-145628236
22 или 67 NT066 NTHI1230
23 NT097 NTHI0522
24 NT007 P48
25 NT006 HtrA
26 NT035 PE
27 NT010 P26
28 NT080 PHiD
29 NT081 P6
30 NT013 NTHI0532
31 NT106 NTHI0363
32 NT107 NTHI0370
33 NT108 NTHI0205
34 NT109 NTHI0374
35 NT110 NTHI0579
36 NT111 NTHI0837
37 NT112 NTHI0849
38 NT113 NTHI0921
39 NT114 NTHI0995
40 NT115 NTHI1091
41 NT116 NTHI1169

42 NT117 NTHI1208
43 NT118 NTHI1318
44 NT123 NTHI1796
45 NT124 NTHI1930
114 NT119 NTHI1565
115 NT120 NTHI1569
116 NT121 NTHI1571
117 NT122 NTHI1667
122 NT004 CGSHiGG_08215
123 NT014 gi-145629254
124 NT022 NTHI0830
128 NT061 NTHI0588
130 NT017 NTHI0915

Ссылочные материалы

[1] Fleischmann et al. (1995) Science 269:496-512.

[2] Li et al. (2003) Mol Microbiol 47:1101-1111.

[3] GenBank accession NC_000907.

[4] WO2005/111066

[5] Murphy et al. Current Infectious Disease report (2009)11:177-182.

[6] Webb DC et al. - Investigation of the potential of a 48 kDa protein as a vaccine candidate for infection against nontypable Haemophilus influenzae. Vaccine. 2007 May 16;25(20):4012-9.

[7] Hallström T et al. - Nontypeable Haemophilus influenzae protein E binds vitronectin and is important for serum resistance. J Immunol. 2009 Aug 15;183(4):2593-601.

[8] Loosmore SM et al. - The Haemophilus influenzae HtrA protein is a protective antigen. Infect Immun. 1998 Mar; 66(3):899-906.

[9] Kyd JM et al. - Potential of a novel protein, OMP26, from nontypeable Haemophilus influenzae to enhance pulmonary clearance in a rat model. Infect Immun. 1998 May;66(5):2272-8.

[10] Ronander E, The Journal of Infectious Diseases (2009): 199 p522-530

[11] WO00/55191.

[12] WO02/24729.

[13] Chanyangam M. et al., (1991) Infection and Immunity, Vol. 59 (2), 600-608

[14] Munson R.S.; Granoff D.M. (1985) Infection and Immunity 49 (3):544-549

[15] Hogg et al. (2007) Genome Biology 8:R103.

[16] Needleman & Wunsch (1970) J. Mol. Biol. 48, 443-453.

[17] Rice et al. (2000) Trends Genet 16:276-277.

[18] Bernadac A., et al. (1998) Journal of Bacteriology 180 (18): 4872-4878

[19] WO2002/062378

[20] Uehara T. et al., The EMBO Journal (2010) 29, 1412-1422

[21] US patent 5,707,829

[22] Current Protocols in Molecular Biology (F.M. Ausubel et al. eds., 1987) Supplement 30.

[23] Vaccine Design (1995) eds. Powell & Newman. ISBN: 030644867X. Plenum.

[24] WO90/14837.

[25] Podda & Del Giudice (2003) Expert Rev Vaccines 2:197-203.

[26] Podda (2001) Vaccine 19: 2673-2680.

[27] Vaccine Adjuvants: Preparation Methods and Research Protocols (Volume 42 of Methods in Molecular Medicine series). ISBN: 1-59259-083-7. Ed. O’Hagan.

[28] US 5,057,540.

[29] Niikura et al. (2002) Virology 293:273-280.

[30] Lenz et al. (2001) J Immunol 166:5346-5355.

[31] Pinto et al. (2003) J Infect Dis 188:327-338.

[32] Gerber et al. (2001) J Virol 75:4752-4760.

[33] WO03/024480.

[34] WO03/024481.

[35] Gluck et al. (2002) Vaccine 20:B10-B16.

[36] Meraldi et al. (2003) Vaccine 21:2485-2491.

[37] Pajak et al. (2003) Vaccine 21:836-842.

[38] Krieg (2003) Nature Medicine 9:831-835.

[39] McCluskie et al. (2002) FEMS Immunology and Medical Microbiology 32:179-185.

[40] WO98/40100.

[41] US 6,207,646.

[42] US 6,239,116.

[43] US 6,429,199.

[44] Schellack et al. (2006) Vaccine 24:5461-72.

[45] Johnson et al. (1999) Bioorg Med Chem Lett 9:2273-2278.

[46] Evans et al. (2003) Expert Rev Vaccines 2:219-229.

[47] Beignon et al. (2002) Infect Immun 70:3012-3019.

[48] Pizza et al. (2001) Vaccine 19:2534-2541.

[49] Pizza et al. (2000) Int J Med Microbiol 290:455-461.

[50] Scharton-Kersten et al. (2000) Infect Immun 68:5306-5313.

[51] Ryan et al. (1999) Infect Immun 67:6270-6280.

[52] Partidos et al. (1999) Immunol Lett 67:209-216.

[53] Peppoloni et al. (2003) Expert Rev Vaccines 2:285-293.

[54] Pine et al. (2002) J Control Release 85:263-270.

[55] WO99/40936.

[56] WO99/44636.

[57] Singh et al] (2001) J Cont Release 70:267-276.

[58] WO99/27960.

[59] US 6,090,406.

[60] US 5,916,588.

[61] EP-A-0626169.

[62] WO99/52549.

[63] Andrianov et al. (1998) Biomaterials 19:109-115.

[64] Payne et al. (1998) Adv Drug Delivery Review 31:185-196.

[65] Stanley (2002) Clin Exp Dermatol 27:571-577.

[66] Jones (2003) Curr Opin Investig Drugs 4:214-218.

[67] WO99/11241.

[68] WO94/00153.

[69] WO98/57659.

[70] European patent applications 0835318, 0735898 and 0761231.

[71] Ogunniyi et al. (2001) Infect Immun 69:5997-6003.

[72] WO2006/110603.

[73] Mason et al. (2003) Infect Immun 71:3454-3462.

[74] Zwijnenburg et al. (2001) J Infect Dis 183:1143-6.

[75] Cheeseman M. T. et al. (2011) PLoS Genetics 7 (10): e1002336.

[76] Watson (2000) Pediatr Infect Dis J 19:331-332.

[77] Rubin (2000) Pediatr Clin North Am 47:269-285, v.

[78] Jedrzejas (2001) Microbiol Mol Biol Rev 65:187-207.

[79] Bell (2000) Pediatr Infect Dis J 19:1187-1188.

[80] Iwarson (1995) APMIS 103:321-326.

[81] Gerlich et al. (1990) Vaccine 8 Suppl:S63-68 & 79-80.

[82] Vaccines (1988) eds. Plotkin & Mortimer. ISBN 0-7216-1946-0.

[83] Del Guidice et al. (1998) Molecular Aspects of Medicine 19:1-70.

[84] Gustafsson et al. (1996) N. Engl. J. Med. 334:349-355.

[85] Rappuoli et al. (1991) TIBTECH 9:232-238.

[86] Costantino et al. (1999) Vaccine 17:1251-1263.

[87] Sutter et al. (2000) Pediatr Clin North Am 47:287-308.

[88] Zimmerman & Spann (1999) Am Fam Physician 59:113-118, 125-126.

[89] McMichael (2000) Vaccine 19 Suppl 1:S101-107.

[90] Schuchat (1999) Lancet 353(9146):51-6.

[91] WO02/34771.

[92] Dale (1999) Infect Dis Clin North Am 13:227-43, viii.

[93] Ferretti et al. (2001) PNAS USA 98: 4658-4663.

[94] Kuroda et al. (2001) Lancet 357(9264):1225-1240; see also pages 1218-1219.

[95] EP-A-0372501

[96] EP-A-0378881

[97] EP-A-0427347

[98] WO93/17712

[99] WO94/03208

[100] WO98/58668

[101] EP-A-0471177

[102] WO00/56360

[103] WO91/01146

[104] WO00/61761

[105] WO01/72337

[106] Research Disclosure, 453077 (Jan 2002)

[107] Brandt et al. (2006) J Antimicrob Chemother. 58(6):1291-4. Epub 2006 Oct 26

[108] Winter et al., (1991) Nature 349:293-99

[109] US 4,816,567.

[110] Inbar et al., (1972) Proc. Natl. Acad. Sci. U.S.A. 69:2659-62.

[111] Ehrlich et al., (1980) Biochem 19:4091-96.

[112] Huston et al., (1988) Proc. Natl. Acad. Sci. U.S.A. 85:5897-83.

[113] Pack et al., (1992) Biochem 31, 1579-84.

[114] Cumber et al., (1992) J. Immunology 149B, 120-26.

[115] Riechmann et al., (1988) Nature 332, 323-27.

[116] Verhoeyan et al., (1988) Science 239, 1534-36.

[117] GB 2,276,169.

[118] Gennaro (2000) Remington: The Science and Practice of Pharmacy. 20th edition, ISBN: 0683306472.

[119] Methods In Enzymology (S. Colowick and N. Kaplan, eds., Academic Press, Inc.)

[120] Handbook of Experimental Immunology, Vols. I-IV (D.M. Weir and C.C. Blackwell, eds, 1986, Blackwell Scientific Publications)

[121] Sambrook et al. (2001) Molecular Cloning: A Laboratory Manual, 3rd edition (Cold Spring Harbor Laboratory Press).

[122] Handbook of Surface and Colloidal Chemistry (Birdi, K.S. ed., CRC Press, 1997)

[123] Ausubel et al. (eds) (2002) Short protocols in molecular biology, 5th edition (Current Protocols).

[124] Molecular Biology Techniques: An Intensive Laboratory Course, (Ream et al., eds., 1998, Academic Press)

[125] PCR (Introduction to Biotechniques Series), 2nd ed. (Newton & Graham eds., 1997, Springer Verlag)

[126] Geysen et al. (1984) PNAS USA 81:3998-4002.

[127] Carter (1994) Methods Mol Biol 36:207-23.

[128] Jameson, BA et al. 1988, CABIOS 4(1):181-186.

[129] Raddrizzani & Hammer (2000) Brief Bioinform 1(2):179-89.

[130] Bublil et al. (2007) Proteins 68(1):294-304.

[131] De Lalla et al. (1999) J. Immunol. 163:1725-29.

[132] Kwok et al. (2001) Trends Immunol 22:583-88.

[133] Brusic et al. (1998) Bioinformatics 14(2):121-30

[134] Meister et al. (1995) Vaccine 13(6):581-91.

[135] Roberts et al. (1996) AIDS Res Hum Retroviruses 12(7):593-610.

[136] Maksyutov & Zagrebelnaya (1993) Comput Appl Biosci 9(3):291-7.

[137] Feller & de la Cruz (1991) Nature 349(6311):720-1.

[138] Hopp (1993) Peptide Research 6:183-190.

[139] Welling et al. (1985) FEBS Lett. 188:215-218.

[140] Davenport et al. (1995) Immunogenetics 42:392-297.

[141] Tsurui & Takahashi (2007) J Pharmacol Sci. 105(4):299-316.

[142] Tong et al. (2007) Brief Bioinform. 8(2):96-108.

[143] Schirle et al. (2001) J Immunol Methods. 257(1-2):1-16.

[144] Chen et al. (2007) Amino Acids 33(3):423-8.

[145] Smith & Waterman (1981) Adv. Appl. Math. 2: 482-489.

[146] Lundström et al. (2008) Biochemistry, 47 (22): 6025-38 Structural analysis of the lipopolysaccharide from nontypeable Haemophilus influenzae strain R2846.

[148] Klock, H.E., et al. (2008). Proteins 71:982-994

[148] Klock, H. E., et al. (2005) J. Struct. Funct. Genomics 6, 89-94

--->

СПИСОК ПОСЛЕДОВАТЕЛЬНОСТЕЙ

<110> Novartis AG

<120> АНТИГЕНЫ И АНТИГЕННЫЕ КОМПОЗИЦИИ

<130> PAT054802-WO-PCT

<140> PCT/EP2013/

<141> Evendate Herewith

<150> GB1207385.4

<151> 2012-04-26

<150> EP12199079.0

<151> 2012-12-21

<160> 131

<170> BiSSAP 1.2

<210> 1

<211> 277

<212> БЕЛОК

<213> Бактерии <прокариоты>

<220>

<223> NT018

<400> 1

Lys His Gly Gln Lys Arg Asp Asp Leu Asn Lys Ala Leu Tyr Phe Ser

1 5 10 15

Arg Leu Glu Glu Ile Glu Gln Asp Asn Ser Gln Gly Leu Val Glu Asn

20 25 30

Val Glu Gln Leu Lys Gln Glu Leu Gln Lys Thr Leu Leu Asp Asp Val

35 40 45

Pro Ser Lys Val Gln Glu Asn Val Asp Tyr Ser Gly Lys Ser Tyr Gly

50 55 60

Lys Ile Trp Phe Val Ser Gly Val Leu Ala Leu Gly Ile Ile Ala Gly

65 70 75 80

Ser Ser Tyr Phe Met Val Gly Ser Trp Gln Ala Glu Ser Met Leu Glu

85 90 95

Gln Thr Tyr Ala Lys Leu Pro Tyr Phe Phe Asp Arg Met Lys Asp Glu

100 105 110

Asp Lys Asn Pro Phe Ser Asp Ala Glu Met Gln Gln Phe Ser Ile Ala

115 120 125

Leu Arg Ile Asp Leu Gln Lys Asn Pro Thr Asp Ala Lys Lys Trp Trp

130 135 140

Met Leu Gly Gln Ile Gly Met Asn Leu Gly Asp Ala Arg Leu Ala Phe

145 150 155 160

Asp Ser Tyr Gln Lys Ala Asn Lys Leu Glu Pro Asp Asn Val Gln Tyr

165 170 175

Lys Leu Gly Tyr Ala Arg Ile Leu Met Phe Ser Glu Asp Ala Thr Asp

180 185 190

Lys Leu Lys Gly Gly Asn Leu Leu Arg Glu Val Ile Arg Gln Glu His

195 200 205

Thr Asn Ile Glu Ala Leu Ser Leu Leu Ala Phe Arg Tyr Phe Glu Thr

210 215 220

Glu Asp Tyr Lys Met Ala Ala Val Thr Trp Ala Met Met Leu Arg Leu

225 230 235 240

Met Pro Lys Asp Asp Glu Arg Val Pro Leu Ile Glu Lys Ser Ile Arg

245 250 255

Thr Ala Arg Asp Ala Leu Glu Ala Gln Asn Glu Glu Lys Ser Lys Ser

260 265 270

Ile Thr Pro Glu Lys

275

<210> 2

<211> 160

<212> БЕЛОК

<213> Бактерии <прокариоты>

<220>

<223> NT024

<400> 2

Met Lys Thr Ile Asp Ile Thr Ala Asn Ser Lys Met Asp Asp Gln Ala

1 5 10 15

Arg Met Asn Leu Ala Gln Glu Phe Ala Asn Lys Gln Gln Trp Ser Ser

20 25 30

Val Phe Asp Ile Met Tyr Pro Met Ala Leu Glu Gly Asn Thr Thr Ala

35 40 45

Gln Ser Asn Leu Gly Met Leu Tyr Asn Leu Gly Arg Gly Thr Val Arg

50 55 60

Asp Tyr Glu Lys Ala Tyr Trp Trp Phe Ser Glu Ala Ala Glu Lys Gly

65 70 75 80

Ser Val Lys Gly Leu Asn Asn Leu Gly Val Met Tyr Leu Arg Gly Asp

85 90 95

Tyr Val Lys Gln Asn Thr Glu Gln Ala Ile Lys Leu Phe Glu Arg Thr

100 105 110

Ala Arg Ala Lys Asp Thr Asp Ala Met Met Met Leu Ser Asn Ile Tyr

115 120 125

Arg Leu Gln Asn Gln Pro Glu Lys Ser Leu Glu Trp Leu Lys Lys Ala

130 135 140

Ala Glu Leu Gly Asn Lys Glu Ala Lys Gln Arg Leu Ser Ser Gln Pro

145 150 155 160

<210> 3

<211> 102

<212> БЕЛОК

<213> Бактерии <прокариоты>

<220>

<223> NT032

<400> 3

Gly Phe Asn Gly Asn Asn Ser Gln Gly Gly Phe Gln Gln Thr Ala Pro

1 5 10 15

Ala Ala Ile Ser Val Lys Gln Ala Leu Ser Ala Ala Asp Asn Ser Met

20 25 30

Ile Thr Leu Val Gly Asn Ile Thr Gln Gln Ile Asp Asp Asp Glu Phe

35 40 45

Trp Phe Thr Asp Gly Thr Gly Gln Ile Lys Ile Glu Ile Lys Lys Arg

50 55 60

Val Trp Asn Gly Leu Asn Val Asp Ser Lys Asp Lys Val Lys Ile Tyr

65 70 75 80

Gly Lys Leu Asp Asn Glu Ala Phe Glu Lys Ala Glu Leu Asp Val Leu

85 90 95

Arg Val Glu Lys Ala Glu

100

<210> 4

<211> 259

<212> БЕЛОК

<213> Бактерии <прокариоты>

<220>

<223> NT038

<400> 4

Lys Gln Asp Gly Ser Ala Asp Met Asp Lys Lys Val Lys Asn Gly Glu

1 5 10 15

Leu Val Lys Thr Lys Val Lys Leu Val Ser Ala Asn Gly Thr Asn Pro

20 25 30

Val Lys Ile Ser Asn Val Ala Glu Gly Thr Glu Asp Thr Asp Ala Val

35 40 45

Ser Phe Lys Gln Leu Lys Ala Leu Gln Asn Lys Gln Val Thr Leu Ser

50 55 60

Ala Ser Asn Ala Tyr Ala Asn Gly Gly Ser Asp Ala Asp Val Gly Lys

65 70 75 80

Val Thr Gln Thr Leu Ser Asn Gly Leu Asn Phe Lys Phe Lys Ser Thr

85 90 95

Asp Gly Glu Leu Leu Asn Ile Lys Ala Asp Lys Asp Thr Val Thr Ile

100 105 110

Thr Arg Ala Ser Gly Ala Asn Gly Ala Ala Ala Thr Asp Ala Asp Lys

115 120 125

Ile Lys Val Ala Ser Asp Gly Ile Ser Ala Gly Asn Lys Ala Val Lys

130 135 140

Asn Val Ala Ala Gly Glu Ile Ser Ala Thr Ser Thr Asp Ala Ile Asn

145 150 155 160

Gly Ser Gln Leu Tyr Ala Val Ala Lys Gly Val Thr Asn Leu Ala Gly

165 170 175

Gln Val Asn Lys Val Gly Lys Arg Ala Asp Ala Gly Thr Ala Ser Ala

180 185 190

Leu Ala Ala Ser Gln Leu Pro Gln Ala Ser Met Pro Gly Lys Ser Met

195 200 205

Val Ser Ile Ala Gly Ser Ser Tyr Gln Gly Gln Ser Gly Leu Ala Ile

210 215 220

Gly Val Ser Arg Ile Ser Asp Asn Gly Lys Leu Ile Ile Arg Leu Ser

225 230 235 240

Gly Thr Thr Asn Ser Gln Gly Lys Thr Gly Val Ala Ala Gly Val Gly

245 250 255

Tyr Gln Trp

<210> 5

<211> 521

<212> БЕЛОК

<213> Бактерии <прокариоты>

<220>

<223> NT067

<400> 5

Val Ile Val Pro Glu Gly Thr Gln Leu Asp Glu Lys Gln His Ile Val

1 5 10 15

Ile Asn Asn Gly Ala Glu Pro Gln Ser Phe Asn Pro His Lys Thr Glu

20 25 30

Gly Val Pro Glu Ser Asn Val Ala Tyr Gln Leu Leu Glu Gly Leu Val

35 40 45

Thr Ser Asp Ser Glu Gly Lys Leu Gln Pro Gly Ala Ala Glu Ser Trp

50 55 60

Glu Asn Thr Pro Asp Phe Lys Thr Trp Thr Phe His Leu Arg Lys Asp

65 70 75 80

Ala Lys Trp Ser Asn Gly Asp Pro Val Thr Ala His Asp Phe Val Phe

85 90 95

Ala Trp Arg Arg Leu Val Asp Pro Ala Thr Ala Ala Pro Tyr Ala Ser

100 105 110

Tyr Leu Ser Tyr Leu Gln Val Glu Asn Ala Gln Asp Ile Ile Asp Gly

115 120 125

Lys Lys Lys Pro Ala Glu Leu Gly Val Glu Ala Lys Asp Asp Tyr Thr

130 135 140

Phe Val Val His Ala Thr Asn Pro Val Pro Tyr Ala Val Ser Leu Thr

145 150 155 160

Thr His Gln Ser Leu Leu Pro Leu Pro Gln Lys Val Val Glu Lys Leu

165 170 175

Gly Asp Ala Trp Val Lys Lys Glu Asn Tyr Val Gly Asn Gly Ala Tyr

180 185 190

Lys Leu Ala Asn His Ile Ile Asn Glu Lys Ile Glu Phe Glu Arg Asn

195 200 205

Pro Leu Tyr Trp Asn Asp Lys Glu Thr Val Ile Asn Ser Ala Thr Phe

210 215 220

Leu Ala Ile Glu Asn Pro Ser Thr Asp Val Ala Arg Tyr Arg Ala Gly

225 230 235 240

Asp Leu Asp Met Thr Ser Tyr Gly Leu Pro Pro Glu Gln Phe Ala Lys

245 250 255

Leu Lys Lys Glu Leu Leu Gly Glu Val Tyr Val Thr Arg Thr Leu Gly

260 265 270

Thr Tyr Ser Tyr Glu Leu Asn Asn Lys Lys Ala Pro Phe Asp Asn Val

275 280 285