04.06.2020
220.018.23f3

СПОСОБ ЛЕЧЕНИЯ БОЛЕЗНЕЙ ГЛАЗ

Вид РИД

Изобретение

Юридическая информация Свернуть Развернуть
№ охранного документа
0002722643
Дата охранного документа
02.06.2020
Краткое описание РИД Свернуть Развернуть
Аннотация: Предложенная группа изобретений относится к области медицины. Предложены способы лечения неоваскулярной возрастной макулярной дегенерации нВМД у млекопитающего, включающие введение млекопитающему трех отдельных доз анти-VEGF антитела, которое включает последовательность SEQ ID NO: 3, с четырехнедельными интервалами. Предложенная группа изобретений обеспечивает эффективное лечение болезней глаз. 2 н. и 12 з.п. ф-лы, 1 ил., 1 табл., 1 пр.
Реферат Свернуть Развернуть

Настоящая заявка испрашивает приоритет предварительной заявки США с серийным номером 62/076,770, поданной 7 ноября 2014 года, и предварительной заявки США с серийным номером 62/088,061, поданной 5 декабря 2014 года, описания изобретения которых включены в данную заявку посредством ссылки.

ОБЛАСТЬ ТЕХНИКИ, К КОТОРОЙ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Изобретение относится к способам лечения болезней глаз при помощи антагонистов фактора роста сосудистого эндотелия. В частности, изобретение относится к лечению неоваскулярных болезней глаз при помощи менее частого приема доз по сравнению с утвержденными на настоящее время режимами лечения. В данной заявке предоставлены способы идентификации пациентов, которые могут получать терапию антагонистом фактора роста сосудистого эндотелия в режиме дозирования каждые 8 недель или 12 недель, где пациенты получали нагрузочную фазу из трех отдельных доз, вводимых с четырехнедельными интервалами.

УРОВЕНЬ ТЕХНИКИ, К КОТОРОМУ ОТНОСИТСЯ ИЗОБРЕТЕНИЕ

Возрастная макулярная дегенерация (ВМД) является основной причиной тяжелых потерь зрения у людей, которая поражает 10%-13% людей в возрасте 65 лет в Северной Америке, Европе и Австралии (Kawasaki 2010, Rein с соавт., Arch Ophthalmol. 2009;127:533-40, Smith 2001). Генетические факторы, факторы окружающей среды и здоровья играют важную роль в патогенезе заболевания.

ВМД подразделяют на два клинических подтипа: не неоваскулярная (атрофическая) или сухая форма и неоваскулярная (экссудативная) или влажная форма (Ferris с соавт., Arch Ophthalmol. 1984;102:1640-2, Lim с соавт., Lancet. 2012;379:1728-38, Miller с соавт., Am J Ophthalmol. 2013;155:1-35). Неоваскулярная ВМД (нВМД) характеризуется ростом новых атипичных кровеносных сосудов (неоваскуляризация) под пигментным эпителием сетчатки (ПЭС, RPE) или в субретинальном пространстве из нижерасположенной сосудистой оболочки (хориоида), что называется хориоидальной неоваскуляризацией (CNV) (Ferris с соавт., Arch Ophthalmol. 1984;102:1640-2). Эти новообразованные сосуды имеют повышенную склонность к протеканию крови и сыворотки крови, повреждая при этом сетчатку, стимулируя воспаление и образование рубцовой ткани. Повреждение сетчатки приводит к прогрессирующей, тяжелой и необратимой потере зрения (Shah с соавт., Am J Ophthalmol. 2007;143:83-89, Shah с соавт., Am J Ophthalmol. 2009;116:1901-07). При отсутствии лечения у большей части глаз будет нарушаться центральное зрение (20/200) в течение 12 месяцев (TAP 2003). Несмотря на то, что неоваскулярная форма заболевания наблюдается всего лишь в приблизительно 10% всех случаев ВМД, на ее долю приходится приблизительно 90% всех тяжелых потерь зрения по причине развития ВМД до начала терапии препаратами, действие которых направлено против фактора роста сосудистого эндотелия (VEGF) (Ferris с соавт., Am J Ophthalmol. 1983;118:132-51, Sommer с соавт., N Engl J Med. 1991;14:1412-17, Wong с соавт., Ophthalmology. 2008;115:116-26).

Оказалось, что у пациентов с нВМД повышена концентрация VEGF, что, как считается, играет ключевую роль в процессе неоваскуляризации (Spilsbury с соавт., Am J Pathol. 2000;157:135-44). Применение интравитреальной (IVT) фармакотерапии, направленной на VEGF, значительно улучшает зрение у пациентов с нВМД (Bloch с соавт., Am J Ophthalmol. 2012;153:209-13, Campbell с соавт., Arch Ophthalmol. 2012;130:794-5). Анти-VEGF терапия, такая как терапия ранибизумабом (препарат LUCENTIS®) и афлиберцептом (EYLEA®), ингибирует сигнальные пути VEGF и демонстрирует остановку роста неоваскулярных очагов и устранение отека сетчатки.

В двух исследованиях применения ранибизумаба 3 Фазы с ежемесячными режимами дозирования приблизительно у 95% участников исследования, получавших терапию ранибизумабом, наблюдалась стабилизация зрения (что определялось как потеря остроты зрения менее, чем на 15 букв по таблице ETDRS) или улучшение зрения через 12 месяцев по сравнению с 62% и 64%, полученными в контрольных группах (Rosenfeld с соавт., N Engl J Med. 2006;355:1419-31, Brown с соавт., N Engl J Med. 2006;355:1432-44). У двадцати пяти - сорока процентов участников исследования в группах терапии ранибизумабом наблюдалось улучшение остроты зрения на ≥ 15 букв к 12 месяцем по сравнению с 5-6% в двух контрольных группах. В среднем у участников исследования, получавших терапию ранибизумабом, наблюдалось улучшение остроты зрения на 7-11 букв через 12 месяцев, в то время как у участников исследования в группе контроля в среднем наблюдалась потеря остроты зрения в количестве 10 букв. Повышение остроты зрения в основном поддерживалось в течение второго года в обоих исследованиях 3 Фазы, в то время как зрение в контрольной группе, в среднем, продолжало ухудшаться. Улучшение остроты зрения, которое демонстрирует скорее приостановку развития нВМД, чем замедление ее развития, подтверждается соответствующим действием на анатомию очага и результаты, полученные от участников исследования. Последние демонстрируют статистически и клинически значимые улучшения зрения на малом расстоянии, зрения на далеком расстоянии и визуально-специфической зависимости, что измеряют при помощи Опросника оценки состояния зрения национального института глаза - 25 (VFQ -25).

В двух параллельных исследованиях применения афлиберцепта 3 Фазы участники исследования с нВМД, не получавшие ранее подобного лечения, были рандомизированы в группы получения 2 доз (0,5 и 2,0 мг) и двух режимов лечения (с дозой 2,0 мг каждые 4 недели и каждые 8 недель) или в контрольную группу (приема ранибизумаба в дозе 0,5 мг каждые 4 недели). К 52 неделе во всех группах получения терапии афлиберцептом независимо от величины дозы и режима дозирования наблюдался результат, не уступающий полученному в группе ранибизумаба при одинаковом сохранении зрения для 95% глаз (Heier с соавт., Ophthalmology. 2012;119:2537-48). В группе приема 2 мг афлиберцепта каждые 4 недели среднее улучшение максимальной остроты зрения с коррекцией (BCVA) наблюдалось в количестве 9,3 букв, и в группе приема 2 мг афлиберцепта каждые 8 недель наблюдалось улучшение в количестве 8,7 букв. На втором году исследования участники исследования были переведены на режим с ограничением максимальной дозы по необходимости (PRN). Доля участников исследования, у которых поддерживалась BCVA, варьировалась между 91% и 92% во всех группах. Среднее улучшение показателей BCVA варьировалось от 7,9 (в группе приема ранибизумаба в дозе 0,5 мг каждые 4 недели), 7,6 (в группе приема афлиберцепта в дозе 2 мг каждые 4 недели и каждые 8 недель) до 6,6 (в группе приема афлиберцепта в дозе 0,5 мг). Во всех группах наблюдалась средняя потеря остроты зрения в количестве 0,8-1,7 букв после перехода с режима приема фиксированных доз на годовой режим приема по необходимости с ограничением максимальной дозы при 4,1 инъекциях для группы приема афлиберцепта в дозе 2 мг каждые 4 недели, 4,2 инъекций в группе приема афлиберцепта в дозе 2 мг каждые 8 недель и 4,7 инъекций в группе приема ранибизумаба в дозе 0,5 мг каждые 4 недели (Schmidt-Erfurth с соавт., Br J Ophthalmol 2014;98:1144-1167 2014;98:1144-1167).

Ежемесячная терапия или терапия каждые 2 месяца оказывает значительную нагрузку не только на пожилых пациентов в целом, но также и на их опекунов и лечащих врачей. Также, несмотря на то, что у терапии имеется положительный баланс пользы и риска, риски не отсутствуют полностью. Каждая инъекция влечет за собой возможную боль, субконъюктивальное кровоизлияние, кровоизлияние в стекловидное тело, разрыв сетчатки, отслойку сетчатки, ятрогенную катаракту и эндофтальмит (Ohr с соавт., Expert Opin. Pharmacother. 2012;13:585-591), а также стабильное повышение внутриглазного давления (ВГД) при сериях инъекций анти-VEGF препаратов (Tseng с соавт., J Glaucoma. 2012;21:241-47). В дополнение, даже при ежемесячных интравитреальных (IVT) инъекциях у 60-70% пациентов наблюдается улучшение остроты зрения менее, чем на 15 букв. Очевидно, что существует лечебная необходимость в разработке препарата, который по сравнению с доступными в настоящее время препаратами, позволит достичь большего улучшения остроты зрения у большего количества пациентов и/или будет иметь пролонгированное терапевтическое действие.

СУЩНОСТЬ ИЗОБРЕТЕНИЯ

Изобретение предоставляет улучшенный способ введения терапевтического антагониста VEGF для лечения болезней глаз, в частности неоваскулярных болезней глаз. В конкретных аспектах изобретение предоставляет способы для лечения неоваскулярных болезней глаз, включающие введение млекопитающему трех отдельных доз антагониста VEGF с четырехнедельным интервалом (т.е., ежемесячно) в последующим введением дополнительных доз каждые 12 недель (q12) и/или каждые 8 недель (q8) в зависимости от результата оценки активности заболевания при помощи определенных заранее визуальных и анатомических критериев.

В некоторых аспектах антагонист VEGF, применяемый в способе изобретения, представляет собой анти-VEGF антитело. В конкретном аспекте анти-VEGF антитело представляет собой одноцепочечное антитело (scFv) или Fab фрагмент. В частности анти-VEGF антитело представляет собой RTH258.

Конкретные предпочтительные варианты осуществления изобретения станут очевидны из следующего далее подробного описания некоторых предпочтительных вариантов осуществления и формулы изобретения.

КРАТКОЕ ОПИСАНИЕ ФИГУР

ФИГ. 1 представляет расписание дозирования для лечения нВМД при помощи RTH258.

ПОДРОБНОЕ ОПИСАНИЕ

Определения

Следующие определения и объяснения предназначены и должны контролировать любые последующие конструкции за исключением ясной и недвусмысленной модификации в последующих примерах или в случае, когда заявка по смыслу представляет любую бессмысленную или по существу бессмысленную конструкцию. В случаях, когда термин будет являться бессмысленным или по существу бессмысленным, определение следует брать из Словаря Уэбстера 3 издания (Webster's Dictionary, 3rd Edition) или из словаря, известного специалисту в данной области техники, такого как Оксфордский словарь по биохимии и молекулярной биологии (Oxford Dictionary of Biochemistry and Molecular Biology, Ed. Anthony Smith, Oxford University Press, Oxford, 2004).

В данной заявке все процентные содержания представляют собой процентное содержание по массе, если не указано иное.

В данной заявке и при отсутствии указаний на иное термины в единственном числе обозначают «один», «по меньшей мере один» или «один или более». Если иное не требуется контекстом, термины в единственном числе, применяемые в данной заявке, включают термины во множественном числе, а термины во множественном числе включают термины в единственном числе.

Содержание любых патентов, патентных заявок и ссылок, процитированных в данном описании, включено в данную заявку во всей полноте посредством ссылки.

Термин «VEGF» относится к фактору роста клеток эндотелия сосудов, состоящего из 165 аминокислот, и к родственным факторам роста клеток эндотелия сосудов, состоящих из 121, 189 и 206 аминокислот, как описано у Leung с соавт., Science 246:1306 (1989) и Houck с соавт., Mol. Endocrin. 5:1806 (1991) вместе с встречающимися в природе аллельными и процессированными формами данных факторов роста.

Термины «рецептор VEGF» или «VEGFr» относятся к клеточному рецептору для VEGF, обычно к рецептору, расположенному на поверхности клетки, который обнаруживается на клетках эндотелия сосудов, а также к его вариантам, которые сохраняют способность связывать hVEGF. Один пример рецептора VEGF представляет собой fms-подобную тирозинкиназу (flt), трансмембранный рецептор семейства тирозинкиназ (DeVries с соавт., Science 255:989 (1992); Shibuya с соавт., Oncogene 5:519 (1990). Рецептор flt включает внеклеточный домен, трансмембранный домен, и внутриклеточный домен, обладающий тирозинкиназной активностью. Внеклеточный домен участвует в связывании VEGF, в то время как внутриклеточный домен принимает участие в сигнальной трансдукции. Другой пример рецептора VEGF представляет собой flk-1 рецептор (также называемый KDR) (Matthews с соавт., Proc. Nat. Acad. Sci. 88:9026 (1991); Terman с соавт., Oncogene 6:1677 (1991); Terman с соавт., Biochem. Biophys. Res. Commun. 187:1579 (1992). Связывание VEGF c flt рецептором приводит к образованию по меньшей мере двух комплексов с высоким молекулярной массой, имеющих среднюю молекулярную массу 205000 и 300000 Дальтон. Комплексы массой 300000 Дальтон считаются димерами, включающими две молекулы рецептора, связанными с одной молекулой VEGF.

Как применяют в данной заявке, термин «антагонист VEGF» относится к соединению, который может снижать или ингибировать активность VEGF in vivo. Антагонист VEGF может связываться с рецептором (-ами) VEGF или блокировать белок (белки) VEGF от связывания с рецептором (-ами) VEGF. Антагонист VEGF может представлять собой, например, небольшую молекулу, анти-VEGF антитело или его антиген-связывающие фрагменты, слитый белок (такой как афлиберцепт), аптамер, антисмысловую молекулу нуклеиновой кислоты и интерферирующую РНК, рецепторные белки и тому подобные образования, способные специфически связываться с одним или более VEGF белков или с одним или более VEGF рецепторов. Некоторые антагонисты VEGF описаны в WO 2006/047325.

В предпочтительном варианте осуществления антагонист VEGF представляет собой анти-VEGF антитело.

Термин «антитело», как применяется в данной заявке, включает полноразмерное антитело и любой антиген-связывающий фрагмент (т.е., «антигенсвязывающую область», «антигенсвязывающий полипептид» или «иммуносвязывающее вещество») или его одну цепь. Термин «антитело» включает гликопротеин, состоящий из по меньшей мере двух тяжелых цепей (Н) и двух легких цепей (L), связанных друг с другом при помощи дисульфидных связей, или его антигенсвязывающую область. Каждая тяжелая цепь состоит из вариабельного участка тяжелой цепи (обозначается в данной заявке сокращением VH) и константного участка тяжелой цепи. Константный участок тяжелой цепи состоит из трех доменов, СН1, СН2 и СН3. Каждая легкая цепь состоит из вариабельного участка легкой цепи (обозначается в данной заявке сокращением VL) и константного участка легкой цепи. Константный участок легкой цепи состоит из одного домена CL. VH и VL участки могут дополнительно подразделяться на участки гипервариабельности, называемые областями, определяющими комплементарность (CDR), которые чередуются с участками, которые являются более стабильными и называются каркасными областями (FR). Каждый участок VH и VL состоит из трех CDR и четырех FR, расположенных от амино-конца до карбокси-конца в следующем порядке: FR1, CDR1, FR2, CDR2, FR3, CDR3, FR4. Вариабельные участки тяжелой и легкой цепей содержат связывающий домен, которые взаимодействует с антигеном. Константные участки антител могут медиировать связывание иммуноглобулина с тканями хозяина или факторы, включающие различные клетки иммунной системы (например, эффекторные клетки) и первый компонент (Clq) классической системы комплемента

Термин «антигенсвязывающая область» антитела (или просто «область антитела») относится к одному или более фрагментам антитела, которые сохраняют способность специфически связываться с антигеном (например, VEGF). Было продемонстрировано, что антигенсвязывающую функцию антитела могут осуществлять фрагменты полноразмерного антитела. Примеры связывающих фрагментов, включенных в термин «антигенсвязывающая область» антитела, включают (i) Fab-фрагмент, моновалентный фрагмент, состоящий из доменов VL, VH, CL и CH1; (ii) F(ab')2-фрагмент, бивалентный фрагмент, включающий два Fab-фрагмента, связанных дисульфидным мостиком в шарнирной области; (iii) Fd-фрагмент, состоящий из доменов VH и CH1; (iv) Fv-фрагмент, состоящий из доменов VL и VH одного плеча антитела, (v) один домен или dAb-фрагмент (Ward с соавт., (1989) Nature 341:544-546), который состоит из VH домена; и (vi) выделенную область, определяющую комплементарность (CDR) или (vii) комбинацию двух или более выделенных CDR, которые опционально могут соединяться синтетическим линкером. Более того, несмотря на то, что два домена Fv-фрагмента, VL и VH, кодируются различными генами, они могут быть объединены с применением рекомбинантных методов при помощи синтетического линкера, который позволяет им существовать как одиночной белковой цепи, в которой области VL и VH образуют пару с образованием моновалентных молекул (известной как одноцепочечный фрагмент Fv (scFv); см., например, Bird с соавт. (1988) Science 242:423-426; and Huston с соавт. (1988) Proc. Natl. Acad. Sci. USA 85:5879-5883). Такие одноцепочечные антитела также предназначены для включения в термин «антигенсвязывающая область» антитела. Данные фрагменты антитела получают с помощью стандартных техник, известных специалистам в данной области техники, и фрагменты изучают на предмет функциональности таким же образом, как изучают интактные антитела. Антигенсвязывающие области можно получать при помощи технологий рекомбинантных ДНК или при помощи ферментативного или химического расщепления интактных иммуноглобулинов. Антитела могут быть представлены различными изотипами, например антителами IgG (например, подтипа IgG1, IgG2, IgG3 или IgG4), IgA1, IgA2, IgD, IgE или IgM.

Как применяют в данной заявке, термин «млекопитающее» включает любое животное, относящееся к классу млекопитающих, включая, но не ограничиваясь людьми, домашними животными, сельскохозяйственными животными или животными-компаньонами и т.д.

Как применяют в данной заявке, термин «участник исследования» или «пациент» относится к млекопитающим, являющимся или не являющимся людьми, включая, но не ограничиваясь приматами, кроликами, свиньями, лошадьми, собаками, кошками, овцами и коровами. Предпочтительно участник исследования или пациент представляет собой человека.

Термины «болезнь глаз» или «неоваскулярная болезнь глаз», которую можно лечить при помощи способов изобретения, включают состояние, заболевание или нарушение, связанные с неоваскуляризацией глаз, включая, но не ограничиваясь атипичным ангиогенезом, хориоидальной неоваскуляризацией (CNV), проницаемостью сосудов сетчатки, отеком сетчатки, диабетической ретинопатией (в частности пролиферативной диабетической ретинопатией), диабетическим макулярным отеком, неоваскулярной (экссудативной) возрастной макулярной дистрофией (ВМД), включая CNV, ассоциированные с нВМД (неоваскулярная ВМД), последствиями, ассоциированными с ишемией сетчатки, окклюзией центральной вены сетчатки (CRVO) и неоваскуляризацией заднего сегмента глаза.

Выбор режимов лечения

Изобретение предоставляет способы определения того, могут ли пациенты, получающие терапию антагонистом VEGF по поводу заболевания глаз, получать терапию каждые восемь недель или каждые двенадцать недель.

Изобретение предоставляет способы лечения неоваскулярных болезней глаз у млекопитающего, включающих неоваскулярную возрастную макулярную дегенерация (нВМД), где способы включают введение многократных доз антагониста VEGF млекопитающему через различные интервалы времени в течение по меньшей мере двух лет. В некоторых вариантах осуществления дозы вводят с четырехнедельным интервалом в сумме 3 доз в целом, после чего вводят дополнительные дозы с восьминедельным, двенадцатинедельным интервалами или в комбинации восьми- и двенадцатинедельного интервалов. Изобретение предоставляет специфические критерии, утвержденные изобретателями, на основании оценки активности заболевания для определения случаев, когда следует применять восьминедельный и двенадцатинедельный интервалы для введения препарата. Изобретение дополнительно предоставляет способы определения случаев, когда интервал между введениями препарата следует переключить на другой. Например, при отборе пациента на получение доз с интервалом 12 недель (после начальных 3 нагрузочных доз, как описано выше), способы изобретения можно применять для определения того, следует ли продолжать вводить дозы пациенту в режиме с двенадцатинедельными интервалами, или следует поменять его на режим с восьминедельными интервалами, и способы изобретения можно применять для определения того, следует ли продолжать вводить дозы пациенту в режиме с восьминедельным интервалом или следует поменять его на режим с двенадцатинедельными интервалами. Таким образом, пациенты могут не оставаться на одном режиме с интервалами для введения препарата, могут менять его на другой и обратно в зависимости от оценок в соответствии с описанными с данной заявке критериями.

В одном варианте осуществления изобретение предоставляет способ лечения болезней глаз, в частности неоваскулярных болезней глаз, который включает введение антагониста VEGF млекопитающему при необходимости в таковом в соответствии с указанным далее расписанием:

«нагрузочная фаза», состоящая из трех доз, которые вводят с четырехнедельными интервалами (например, на 0 неделе, 4 неделе, 8 неделе), и

дополнительные дозы, которые вводят с восьминедельными (q8) и/или двенадцатинедельными (q12) интервалами в зависимости от критериев выбора, дополнительно описанных в данной заявке.

Оценку активности заболевания проводят, например, на 16, 20, 32 и 44 Неделях после первой инъекции антагониста VEGF, что обеспечивает 4 момента времени до конца первого года терапии (48 Неделя), при которой пациенты, получающие препарат с двенадцатинедельными интервалами, в конкретных вариантах изобретения, могут быть переведены на восьминедельные интервалы. Ожидается, что такое раннее определение участников исследования, которым больше подходит режим дозирования с восьминедельными интервалами, на 16 Неделе минимизирует долю участников исследования в процентах, получающих терапию с двенадцатинедельными интервалами, которым потребуется смена режима терапии в более поздние периоды времени (смена также разрешена на 20, 32 или 44 Неделях). Результаты анализов, полученных в исследованиях PIER и EXCITE, демонстрируют, что зрительный и анатомический ответы во время и сразу после проведения нагрузочной фазы ассоциированы с результатами, полученными для остроты зрения у остальных участников первого года терапии. Недавние результаты анализов, полученные в исследовании EXCITE, также продемонстрировали, что у участников исследования, которые потеряли зрение в течение начальной нагрузочной фазы, будут наблюдаться лучшие результаты по зрению при более частом получении препарата по сравнению с двенадцатинедельными интервалами. Недавние результаты исследований, полученных в исследованиях CATT и EXCITE, продемонстрировали, что образование новой интраретинальной жидкости/кист, и в меньшей степени повышение CSFT ассоциированы со снижением остроты зрения. Данные динамические критерии подтверждают их применение на 16 Неделе при оценки активности заболевания.

В одном варианте осуществления оценку пациентов, получивших начальные три дозы антагониста VEGF, проводят на 12, 16, 20, 32 и 44 Неделях для определения того, требуется ли им введение дополнительных доз с восьминедельными интервалами или двенадцатинедельными интервалами.

В другом варианте осуществления оценку пациентов, получивших начальные три дозы антагониста VEGF, проводят на втором году терапии на 48, 56, 68 и 80 Неделях для определения того, требуется ли им введение дополнительных доз с восьминедельными интервалами или двенадцатинедельными интервалами.

На момент наступления недель оценки пациенты могут находиться на режимах лечения с восьминедельным или двенадцатинедельным интервалами. Таким образом, оценка может определить, останется ли пациент на текущем режиме, или его переводят на другой.

Оценка, как описано в данной заявке, включает определение максимальной остроты зрения с коррекцией (BCVA), остроты зрения (VA), толщины центрального подполя (CSFT), которые определяют при помощи спектральной оптической когерентной томографии (SD-OCT) и/или в соответствии с образованием новых или ухудшением состояния имевшихся интраретинальных кист/интраретинальной жидкости (IRC/IRF).

Средства определения и мониторинга VA, BCVA, CSFT и IRC/IRF хорошо понимаются и часто применяются специалистами в данной области техники. Для примера, эффективность зрения пациента можно мониторировать при оценке изменений количества букв, которые видит пациент, среднего изменения показателя BCVA от исходного до желаемого периода времени. Исходным показателем, например, может быть VA в начале терапевтического лечения или в определенный период времени после начала лечения.

В некоторых вариантах осуществления способы изобретения включают определение среднего изменения показателя BCVA по сравнению с исходным в определенный период времени (например, с 12 Недели по 16 Неделю), а также оценку того, потерял ли пациент способность видеть меньшее количество букв остроты зрения в определенный период времени по сравнению с исходным (например, с 12 Недели по 16 Неделю).

В некоторых вариантах осуществления критерии выбора для определения того, должен ли пациент лечиться с восьминедельным или двенадцатинедельным интервалами после начальных 3 доз, которые получали с четырехнедельными интервалами, выглядят следующим образом:

0 Неделя - 48 Неделя

При соответствии пациенты распределяются в группу получения инъекций антагониста VEGF каждые 8 недель (q8) вплоть до 48 Недели.

На 16 Неделе:

Снижение показателя BCVA на ≥5 букв по причине активности неоваскулярной ВМД (нВМД) на 16 Неделе по сравнению с исходным показателем.

Снижение показателя BCVA на ≥5 букв по причине активности нВМД на 16 Неделе по сравнению с 12 Неделей.

Снижение показателя VA на ≥3 букв и повышение показателя CSFT ≥75мкм на 16 Неделе по сравнению с 12 Неделей.

Появление новых или ухудшение состояния имевшихся интраретинальных кист (IRC)/интраретинальной жидкости (IRF) на 16 Неделе по сравнению с 12 Неделей.

На 20, 32 и 44 Неделях:

Снижение показателя BCVA на ≥5 букв по причине активности нВМД по сравнению с 12 Неделей.

В других вариантах осуществления способ изобретения включает дополнительные измерения через 48 недель после начала лечения, которые выглядят следующим образом:

48 Неделя - 96 Неделя

Пациентов, которых определяют для терапии с восьминедельными интервалами на 16 и 20 Неделе, переводят на режим лечения с двенадцатинедельными интервалами на второй год лечения, если они не соответствуют каким-либо из указанных далее критериев:

На 48 Неделе:

Снижение показателя BCVA на ≥5 букв по причине активности нВМД на 48 Неделе по сравнению с 32 Неделей.

Появление новых или ухудшение состояния имевшихся IRC/IRF на 48 Неделе по сравнению с 32 Неделей.

Пациенты, вступающие во второй год терапии с режимом с двенадцатинедельными интервалами, остаются на данном режиме терапии с двенадцатинедельными интервалами за исключением случаев, когда они соответствуют следующим критериям на момент любого из указанных визитов:

На 56, 68 и 80 Неделе:

Снижение показателя BCVA не ≥5 букв по причине активности нВМД по сравнению с 48 Неделей.

Анти-VEGF антитела

В конкретных вариантах осуществления антагонист VEGF, применяемый в методе изобретения, представляет собой VEGF антитело, в частности, анти-VEGF антитела, описанные в заявке WO 2009/155724, которая включена в данную заявку во всей полноте посредством ссылки.

В одном варианте осуществления анти-VEGF антитело изобретения включает вариабельную тяжелую цепь, имеющую последовательность, как указано в SEQ ID NO: 1, и вариабельную легкую цепь, имеющую последовательность, как указано в SEQ ID NO: 2.

VH: SEQ ID NO. 1

EVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS

VL: SEQ ID NO. 2

EIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLG

В другом варианте осуществления анти-VEGF антитело, применяемое в способе изобретения, включает последовательность, как указано в SEQ ID NO: 3.

EIVMTQSPSTLSASVGDRVIITCQASEIIHSWLAWYQQKPGKAPKLLIYLASTLASGVPSRFSGSGSGAEFTLTISSLQPDDFATYYCQNVYLASTNGANFGQGTKLTVLGGGGGSGGGGSGGGGSGGGGSEVQLVESGGGLVQPGGSLRLSCTASGFSLTDYYYMTWVRQAPGKGLEWVGFIDPDDDPYYATWAKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAGGDHNSGWGLDIWGQGTLVTVSS

В предпочтительном варианте осуществления анти-VEGF антитело, применяемое в способе изобретения, представляет собой RTH258 (которое включает SEQ ID NO: 3). RTH258 представляет собой одноцепочечный вариабельный Fv фрагмент (scFv) гуманизированного антитела, ингибитор VEGF, имеющий молекулярный вес ~26 кДа. Он представляет собой ингибитор VEGF-A и действует путем связывания с сайтом связывания рецептора молекулы VEGF-A, таким образом предотвращая взаимодействия VEGF-A с его рецепторами VEGFR1 и VEGFR2 на поверхности эндотелиальных клеток. Повышенные уровни сигналов по VEGF пути ассоциированы с атипичным ангиогенезом в глазах и отеком сетчатки. Ингибирование VEGF пути продемонстрировало ингибирование роста неоваскулярных очагов и разрешение отека сетчатки у пациентов, имеющих нВМД.

Фармацевтические составы

В одном аспекте способы изобретения включают применение фармацевтических составов, включающих анти-VEGF антитела. Термин «фармацевтический состав» относится к составам, которые находятся в такой форме, чтобы обеспечить биологическую активность антитела или производного антитела для получения эквивалентной эффективности, и которые не содержат дополнительных компонентов, которые являются токсичными для участник исследования, которым будет вводиться данный состав. «Фармацевтически приемлемые» эксципиенты (основы, не содержащие действующее вещество, добавки) представляют собой те, которые могут обоснованно вводиться участнику исследования, млекопитающему, для предоставления эффективной дозы применяемого активного ингредиента.

«Стабильный» состав представляет собой состав, в котором антитело или производное антитела сохраняет свою физическую стабильность и/или химическую стабильность и/или биологическую активность при хранении. В данной области техники доступны различные аналитические технологии для определения стабильности белка, их обзор имеется, например, в Peptide and Protein Drug Delivery, 247-301, Vincent Lee Ed., Marcel Dekker, Inc., New York, N.Y., Pubs. (1991) and Jones, A. Adv. Drug Delivery Rev. 10: 29-90 (1993). Стабильность можно определить для выбранной температуры для выбранного периода времени. Предпочтительно состав является стабильным при комнатной температуре (приблизительно 30o C) или при 40o C в течение по меньшей мере 1 недели и/или является стабильным при приблизительно 2-8° C в течение периода по меньшей мере от 3 месяцев до 2 лет. Более того, состав является предпочтительно стабильным после замораживания (до, например, -70o C) и оттаивания состава.

Антитело или производное антитела «сохраняет свою физическую стабильность» в фармацевтическом составе, если он соответствует определенной спецификации для выпуска продукта в отношении агрегации, распада, преципитации и/или денатурации при визуальном осмотре цвета и/или прозрачности, или при рассеивании УФ-света или гель-фильтрационной хроматографии или при применении других подходящих способов, признанных в данной области техники.

Антитело или производное антитела «сохраняет свою химическую стабильность» в фармацевтическом составе, если химическая стабильность в определенный момент времени является таковой, что считается, что белок сохраняет свою биологическую активность, как определено далее. Химическую стабильность можно оценить путем определения наличия и определения количества химически измененных форм белка. Химическое изменение может включать модификацию размера (например, клипирование), которое можно оценивать, например, при помощи гель-фильтрационной хроматографии, электрофореза в полиакриламидном геле в присутствии додецилсульфата натрия (ДСН-ПААГ, SDS-PAGE) и/или времяпролетной масс-спектрометрии с лазерной ионизацией и десорбцией из жидкой матрицы (MALDI/TOF MS). Другие типы химических изменений включают изменение заряда (например, происходящее в результате деамидирования), что можно оценить, например, при помощи ионообменной хроматографии.

Антитело или производное антитела «сохраняет свою биологическую стабильность» в фармацевтическом составе, если биологическая активность в определенный момент времени находится в пределах 10% (в пределах погрешностей анализов) биологической активности, демонстрируемой в то время, когда был приготовлен фармацевтический состав, что определяют, например, при помощи реакции связывания антигена. Другие анализы для исследования «биологической активности» антител уточнены далее в данной заявке.

Термин «изотонический» означает то, что интересующий состав исходно имеет такое же осмотическое давление, что и кровь человека. Изотонические составы в целом имеет осмотическое давление от приблизительно 250 до 350 мОсм. Изотоничность можно измерить, например, при помощи парофазного или криоскопического осмометра.

Термин «полиол» представляет собой вещество с несколькими гидроксильными группами и включает сахара (редуцирующие и нередуцирующие сахара), сахароспирты и сахарные кислоты. Предпочтительные полиолы в данной заявке имеют молекулярную массу менее приблизительно 600 кДа (например, в диапазоне от приблизительно 120 до приблизительно 400 кДа). Термин «редуцирующий сахар» представляет собой сахар, который содержит полуацетальную группу, которая может восстанавливать ионы металлов или которая может взаимодействовать ковалентно с лизином и другими аминогруппами в белках, а «нередуцирующий сахар» представляет собой сахар, который не имеет подобных свойств, характерных для редуцирующего сахара. Примерами редуцирующих сахаров являются фруктоза, манноза, мальтоза, лактоза, арабиноза, ксилоза, рибоза, рамноза, галактоза и глюкоза. Нередуцирующие сахара включают сахарозу, трегалозу, сорбозу, мелецитозу и раффинозу. Маннитол, ксилитол, эритрол, треит, сорбит и глицерол представляют собой примеры сахароспиртов. Что касается сахарных кислот, они включают L-глюконат и его соли металлов. При наличии потребности в стабильности состава при замерзании и оттаивании полиол предпочтительно представляет собой тот, который не кристаллизуется при низких температурах (например, -20o C), чтобы не дестабилизировать антитело в составе. Нередуцирующие сахара, такие как сахароза и трегалоза, являются предпочтительными полиолами в данной заявке, при этом предпочтение отдается трегалозе по сравнению с сахарозой по причине большей стабильности раствора трегалозы.

Как применяют в данной заявке, термин «буфер» относится к буферному раствору, который противодействует изменению pH при помощи действия его соединений кислотно-основных конъюгатов. Буфер в данном изобретении имеет pH в диапазоне от приблизительно 4,5 до приблизительно 8,0; предпочтительно от приблизительно 5,5 до приблизительно 7. Примеры буферов, которые будут контролировать pH в данном диапазоне, включают ацетат (например, ацетат натрия), сукцинат (такой как сукцинат натрия), глюконат, гистидин, цитрат и другие буферы органических кислот. При наличии потребности в стабильности состава при замерзании и оттаивании буфер предпочтительно не является фосфатным.

С фармакологической точки зрения в контексте настоящего изобретения термин «терапевтически эффективное количество» антитела или производного антитела относится к количеству, которое является эффективным для профилактики развития или лечения нарушения, для лечения которого антитело или производное антитела являются эффективными. Термин «заболевание/нарушение» представляет собой любое состояние, которое выигрывает от лечения при помощи антитела или производного антитела. Он включает хронические и острые нарушения или заболевания, включая те патологические состояния, которые обеспечивают предрасположенность млекопитающего к нарушению, о котором идет речь.

Термин «консервант» представляет собой соединение, которое может быть включено в состав для природного снижения в нем бактериальной активности, что таким образом облегчает производство, например, состава многократного применения. Примеры потенциальных консервантов включают хлорид октадецилдиметилбензиламмония, хлорид гексаметония, хлорид бензалкония (смесь хлоридов алкилбензилдиметиламмония, в которых алкильные группы представляют собой длинноцепочечные соединения) и бензетония хлорид. Прочие типы консервантов включают ароматические спирты, такие как фенолоспирт, бутиловый спирт и бензиловый спирт, алкилпарабены, такие как метил- и пропилпарабен, катехин, резорцин, циклогексанол, 3-пентанол и м-крезол. Наиболее предпочтительным консервантом в данной заявке является бензиловый спирт.

Фармацевтические композиции, применяемые в настоящем изобретении, включают антагонист VEGR, предпочтительно анти-VEGF антитело, вместе с по меньшей мере одним физиологически приемлемым носителем или эксципиентом. Фармацевтическая композиция может включать, например, один или более компонент, выбираемый из воды, буферов (например, нейтрального забуферированного физиологического раствора или фосфатного забуферированного физиологического раствора), этанола, минерального масла, растительного масла, диметилсульфоксида, углеводов (например, глюкозы, маннозы, сахарозы или декстранов), маннитола, белков, адъювантов, полипептидов или аминокислот, таких как глицин, антиоксидантов, хелатирующих средств, таких как этилендиаминтетрауксусная кислота (ЭДТК, EDTA) или глутатион, и/или консервантов. Как отмечено выше, прочие активные ингредиенты могут быть включены (но необходимости в этом нет) в фармацевтические композиции, предоставленные в данной заявке.

Носитель представляет собой вещество, которое может быть связано с антителом или производным антитела, перед введением пациенту, часто с целью контроля стабильности или биодоступности соединения. Носители, которые являются в целом биосовместимыми для применения в данных составах, также могут быть биодеградируемыми. Носители включают, например, моновалентные или поливалентные молекулы, такие как сывороточный альбумин (например, человеческий или бычий), яичный альбумин, пептиды, полилизин и полисахариды, такие как аминодекстран и полиамидоамины. Носители также включают твердые вспомогательные материалы, такие как гранулы и микрочастицы, включающие, например, полилактат поликликолят, сополимер лактида с гликолидом, полиакрилат, латекс, крахмал, целлюлозу или декстран. Носитель может переносить соединения различными путями, включая ковалентное связывание (либо напрямую, либо при помощи группы-линкера), нековалентного взаимодействия или в виде примеси.

Фармацевтические композиции могут быть изготовлены для любого подходящего способа введения, включая, например, топическое, внутриглазное, пероральное, назальное, ректальное или парентеральное введение. В некоторых вариантах осуществления композиция находится в предпочтительной форме, подходящей для внутриглазной инъекции, такой как интравитреальная инъекция. Прочие формы включают, например, пилюли, таблетки, пастилки, таблетки для рассасывания, водные или масляные суспензии, растворимые порошки или гранулы, эмульсии, твердые или мягкие капсулы или сиропы и эликсиры. В других вариантах осуществления композиции, предоставленные в данной заявке, могут быть изготовлены в форме лиофилизата. Термин «парентерально», как применяют в данной заявке, включает подкожную, внутрикожную, внутрисосудистую (например, внутривенную), внутримышечную, спинальную, интракраниальную, интратекальную или интраперитонеальную инъекции, а также любые сходные техники инъекции или инфузии.

Фармацевтическая композиция может быть изготовлена в виде стерильного инъекционного раствора или маслянистой суспензии, в которой активные ингредиент (т.е., антагонист VEGF) в зависимости от основы, не содержащей действующее вещество, и применяемой концентрации, либо суспендирован, либо растворен в основе, не содержащей действующее вещество. Такую композицию можно изготовить в соответствии с известным уровнем техники при помощи подходящих диспергирующих, увлажняющих средств и/или суспендирующих средств, таких, как упомянутые ранее. Среди приемлемых основ, не содержащих действующее вещество, и растворителей, которые можно применять, находится вода, 1,3-бутандиол, раствор Рингера и изотонический раствор хлорида натрия. В дополнение, в качестве растворителя или суспендирующей среды можно применять стерильные нелетучие масла. Для данной цели можно применять легкое нелетучее масло, включая синтетические моно- и диглицериды. В дополнение можно применять жирные кислоты, например, олеиновую кислоту, для приготовления инъекционных композиций, а также адьюванты, такие как местные анестетики, консерванты и/или буферные средства, могут быть растворены в основе, не содержащей действующее вещество.

Дозировка

Доза, применяемая в способе изобретения, основывается на конкретном заболевании или состоянии, которое требует лечения. Термин «терапевтически эффективная доза» определяют как количество вещества, достаточное для достижения или по меньшей мере частичного достижения желаемого эффекта. Терапевтически эффективной дозы достаточно, если она может вызвать даже постепенное изменение симптомов или состояний, ассоциированных с заболеванием. Терапевтически эффективная доза не должна полностью излечивать заболевание или полностью элиминировать симптомы. Предпочтительно терапевтически эффективная доза может по меньшей мере частично приостановить развитие заболевания или его осложнений у пациента, уже страдающего данным заболеванием. Количества, эффективные для данного применения, будут зависеть от тяжести заболевания, которое лечат, и общего состояния собственной иммунной системы пациента.

Величину дозы можно с готовностью определить, применяя техники по коррекции дозы, известные лечащему врачу, который является специалистом в лечении заболевания или состояния. Терапевтически эффективное количество антагониста VEGF, применяемого в данном способе изобретения, определяют, принимая во внимание, например, желаемые объемы дозы и способ (-ы) введения. Обычно терапевтически эффективные композиции вводят в дозе, которая находится в диапазоне от 0,001 мг/мл до приблизительно 200 мг/мл на дозу. Предпочтительно дозы, применяемые в способе изобретения, составляют от приблизительно 60 мг/мл до приблизительно 120 мг/мл (т.е., равны приблизительно 60, 70, 80, 90, 100, 110 или 120 мг/мл). В предпочтительном варианте осуществления доза анти-VEGF антитела, применяемого в способе изобретения, составляет 60 мг/мл или 120 мг/мл.

Водный состав анти-VEGF антитела, применяемого в способе изобретения, изготавливают в pH-буферном растворе. Предпочтительно буфет такого водного состава имеет pH в диапазоне от приблизительно 4,5 до приблизительно 8,0, предпочтительно от приблизительно 5,5 до приблизительно 7,0, наиболее предпочтительно он равен 6,75. Примеры буферов, которые будут контролировать нахождение pH в пределах данного диапазона, включают ацетат (например, ацетат натрия), сукцинат (такой, как сукцинат натрия), глюконат, гистидин, цитрат и прочие буферы органических кислот. Концентрация буфера может составлять от приблизительно 1 ммоль до приблизительно 50 ммоль, предпочтительно от приблизительно 5 ммоль до приблизительно 30 ммоль в зависимости от, например, от буфера и желаемой изотоничности состава.

Полиол, который действует в роли вспомогательного вещества, можно применять для стабилизации антитела в водном составе. В предпочтительных вариантах осуществления полиол представляет собой нередуцирующий сахар, такой как сахароза или трегалоза. При желании полиол добавляют в состав в количестве, которое может варьироваться в зависимости от желаемой изотоничности состава. Предпочтительно водный состав является изотоничным, при этом подходящие концентрации полиола в составе находятся в диапазоне от приблизительно 1% до приблизительно 15% масс./об., предпочтительно, например, в диапазоне от приблизительно 2% до приблизительно 10% масс./об. Тем не менее, гипертонические и гипотонические составы также могут быть подходящими. Количество добавляемого полиола также может меняться в зависимости от молекулярной массы полиола. Например, можно добавлять меньшее количество моносахарида (например, маннитола) по сравнению с дисахаридом (например, трегалозой).

Сурфактант также добавляют к водному составу антитела. Типичные сурфактанты включают неионные сурфактанты, такие как полисорбаты (например, полисорбаты 20, 80 и т.д.) или полоксамеры (например, полоксамер 188). Количество добавляемого сурфактанта определяют таким образом, чтобы он снижал агрегацию образованного антитела/производного антитела и/или минимизировал образование твердых частиц в составе и/или снижал всасывание. Например, сурфактант может присутствовать в составе в количестве от приблизительно 0,001% до приблизительно 0,5%, предпочтительно в количестве от приблизительно 0,005% до приблизительно 0,2%, и наиболее предпочтительно в количестве от приблизительно 0,01% до приблизительно 0,1%.

В одном варианте осуществления водный состав антитела, применяемый в способе изобретения, исходно не содержит один или более консервантов, таких как бензиловый спирт, фенол, м-крезол, хлоробутанол и хлорид бензетония. В другом варианте осуществления консервант может быть включен в состав, в частности в случае когда состав представляет собой многодозовый состав. Концентрация консерванта может находиться в диапазоне от приблизительно 0,1% до приблизительно 2%, наиболее предпочтительно от приблизительно 0,5% до приблизительно 1%. Один или более фармацевтически приемлемые носители, эксципиенты или стабилизаторы, как те, которые описаны в Remington's Pharmaceutical Sciences 21st edition, Osol, A. Ed. (2006), могут быть включены в состав, поскольку они не оказывают нежелательного эффекта на желаемые характеристики состава. Приемлемые носители, эксципиенты или стабилизаторы являются нетоксичными для реципиентов в применяемых дозировках и концентрациях и включают: дополнительные буферные средства, сорастворители, антиоксиданты, включая аскорбиновую кислоту и метионин, хелатирующие средства, такие как ЭДТК, комплексы металлов (например, комплексы белка и цинка), биодеградируемые полимеры, такие как полиэфиры, и/или солеобразующие противоионы, такие как натрий.

Составы для применения с введением in vivo должны быть стерильными. Это без труда обеспечивается фильтрацией через стерильные фильтрационные мембраны до или после приготовления состава.

В одном варианте осуществления антагонист VEGF вводят в один глаз млекопитающего при необходимости в лечении в соответствии с известными способами доставки препаратов в глаз. Предпочтительно млекопитающее представляет собой человека, антагонист VEGF представляет собой анти-VEGF антитело, и антитело вводят напрямую в глаз. Введение препарата пациенту может быть выполнено, например, при помощи интравитреальной инъекции.

Антагонист VEGF в способе изобретения можно вводить в качестве отдельного вида терапии или в сочетании с другими лекарственными средствами или видами терапии при лечении состояния, о котором идет речь.

Предпочтительный состав для RTH258 для интравитреальной инъекции продемонстрирован в таблице, расположенной далее. Предпочтительные концентрации RTH258 составляют 6 мг/50 мкл и 3 мг/50 мкл.

Таблица 1

Предпочтительный водный состав

Вещество Концентрация (масс./об. %) Диапазон концентрации (масс./об. %)
RTH258 12 6-12
Лимонная кислота, безводная 0,009 0,006-0,012
Тринатрий цитрат (дигидрат) 0,428 0,285-0,57
Сахароза 6,75 6,75
Полисорбат 80 0,05% 0,05%
Хлористоводородная
кислота или гидроксид натрия
pH 6,75 pH 6,75
Вода для инъекции Сколько потребуется до
100
Сколько потребуется
до100

Следующие примеры включены для демонстрации предпочтительных вариантов осуществления изобретения. Специалистам в данной области техники будет ясно, что техники, раскрытые в примерах, которые расположены далее, представляют техники, раскрытые изобретателем как хорошо функционирующие на практике изобретения и которые, таким образом, можно считать составляющими предпочтительные способы для его практики. Тем не менее, специалистам в данной области техники в свете настоящего раскрытия следует учитывать, что многие изменения могут быть сделаны в конкретных раскрытых вариантах осуществления при получении подобного или сходного результата без отступления от существа и объема изобретения.

Пример, расположенный далее, представляет предпочтительный способ изобретения в течение более чем двухлетнего периода лечения. Несмотря на это, следует понимать, что вариации следующих данных находятся в пределах объема изобретения, и конкретные вариации прочих предпочтительных вариантов осуществления описаны в данной заявке. В дополнение, следует понимать, что период лечения может иметь продолжительность более двух лет, и оценки можно проводить на усмотрение лечащего время или по такому же расписанию, которое описано для периода лечения продолжительностью два года (т.е., начало третьего года считается 0 неделей, и оценку производят на неделях, отсчитываемых с 0 недели 3 года).

ПРИМЕРЫ

Две группы участников исследования, не получавших ранее лечения в отношение активной хориоидальной васкуляризации из-за ВМД получали несколько инъекций RTH258. Одна группа получала дозу RTH258 3 мг/50 мкл, вторая группа получала дозу RTH258 6 мг/50 мкл, вначале вводимые три раза с четырехнедельными интервалами (0 День, 4 Неделя и 8 Неделя), после чего инъекции (интравитреальные) проводились каждые 12 недель (q12) в течение первого года (48 Неделя) за исключением случаев, когда участники исследования соответствовали критериями, перечисленными далее для периода с 0 Недели по 48 Неделю, в любой из последующих визитов. Если имело место соответствие критериям, участники исследования начинали получать инъекции каждые 8 недель (q8) вплоть до 48 Недели. Начиная с 16 Недели во время визитов, в которые пациенты не получали инъекцию активного вещества, проводилась имитацию инъекции. Для имитации инъекции использовали колпачок инъекционного шприца (канюлю без иглы). Все дозы доставлялись в 50 мкл (0,05 мл).

Оценку исследуемого глаза проводят перед, непосредственно (через 0-5 минут) после инъекции/имитации инъекции и через 30 (±15) минут после каждой инъекции/имитации инъекции для гарантирования того, что процедура и/или исследуемый препарат не подвергает опасности здоровье глаза.

Оценку исследуемого глаза у всех участников исследования проводили во время 6 Визита/на 16 Неделе, во время 7 Визита/на 20 Неделе, во время 10 Визита/на 32 Неделе, во время 13 Визита/на 44 Неделе, во время 16 Визита/на 56 Неделе, во время 19 Визита/на 68 Неделе и во время 22 Визита/на 80 Неделе. Если у участника исследования имело место появление новой или ухудшение имевшейся активности заболевания, что определяли в соответствии с критериями, конкретно указанными далее, участник исследования переводился на режим лечения с восьминедельными интервалами.

На 48 Неделе оценку исследуемого глаза участника исследования проводили на предмет отсутствия новой или ухудшения имевшейся активности заболевания. Если пациента переводили на лечение с восьминедельными интервалами на 16 Неделе или 20 Неделе, и у него наблюдалась новая или ухудшение имевшейся активности заболевания, как определено далее, участника исследования переводили на режим лечения с двенадцатинедельными интервалами.

Оценку активности заболевания проводили на 16, 20, 32 и 44 Неделе, что обеспечивало четыре момента времени до первичной конечной точки исследования (48 Неделя), на которой пациентов, получавших лечение с двенадцатинедельными интервалами, могли перевести на лечение с восьминедельными интервалами. Ожидалось, что раннее определение участников исследования, которым больше подходит режим дозирования с восьминедельными интервалами на 16 Неделе, минимизирует долю пациентов с двенадцатинедельными интервалами, которым потребуется смена режима в более поздние моменты времени (перевод также разрешен на 20, 32 или 44 Неделе).

Тестирование остроты зрения в Исследовании раннего лечения диабетической ретинопатии (ETDRS) осуществляют до проведения любого обследования, требующего введения глазных капель для расширения зрачка, или обследования, требующего контакта с глазом. Тестирование остроты зрения проводится после определения рефракции и выполняется в соответствии со стандартной процедурой.

Толщину центрального подполя (CSFT) измеряют при помощи SD-OCT.

Следующие критерии применяют в течение первого года и второго года для определения режим дозирования для каждого участника исследования в исследовании.

0 День - 44 Неделя

При соответствии следующим критериям участников исследования, которым сначала проводились инъекции три раза с четырехнедельными интервалами (0 День, 4 Неделя и 8 Неделя), переводят на получения инъекций каждые 8 недель (q8) вплоть до 48 Недели.

На 16 Неделе:

Снижение показателя BCVA на ≥5 букв по причине активности неоваскулярной ВМД (нВМД) на 16 Неделе по сравнению с исходным показателем (который оценивают на 0 День).

Снижение показателя BCVA на ≥5 букв по причине активности нВМД на 16 Неделе по сравнению с 12 Неделей.

Снижение показателя VA на ≥3 букв и повышение показателя CSFT ≥75мкм на 16 Неделе по сравнению с 12 Неделей.

Появление новых или ухудшение состояния имевшихся интраретинальных кист (IRC)/интраретинальной жидкости (IRF) на 16 Неделе по сравнению с 12 Неделей.

На 20, 32 и 44 Неделях:

Снижение показателя BCVA на ≥5 букв по причине активности нВМД по сравнению с 12 Неделей.

48 Неделя - 96 Неделя

Пациенты, которые определяют для терапии с восьминедельными интервалами на 16 и 20 Неделях могут быть переведены на режим лечения с двенадцатинедельными интервалами на второй год терапии, если они не соответствуют следующим критериям:

На 48 Неделе:

Снижение показателя BCVA на ≥5 букв по причине активности нВМД на 48 Неделе по сравнению с 32 Неделей.

Появление новых или ухудшение состояния имевшихся IRC/IRF на 48 Неделе по сравнению с 32 Неделей.

Пациенты, вступающие во второй год терапии с режимом с двенадцатинедельными интервалами, продолжают режим терапии с двенадцатинедельными интервалами за исключением случаев, когда они соответствуют следующим критериям на момент любого из следующих визитов:

На 56, 68 и 80 Неделе:

Снижение показателя BCVA не ≥5 букв по причине активности нВМД по сравнению с 48 Неделей.

Ожидается, что у участников исследования будет наблюдаться благоприятное изменение показателя BCVA по сравнению с исходным на 48 Неделе, а также улучшенные результаты, полученные от участников исследования, в течение периода времени вплоть до 96 Недели и включая ее, в что определяет более эффективные, менее частый режим лечения для некоторых участников исследования относительно текущих режимов лечения, доступных для лечения участников исследования, имеющих неоваскулярную болезнь глаз.

Настоящее изобретение и его варианты осуществления описаны подробно. Тем не менее, объем настоящего изобретения не предназначен для того, чтобы быть ограниченным конкретными вариантами осуществления какого-либо способа, производства, смеси химически связанных веществ, соединений, средств, способов и/или стадий, описанных в описании. Можно производить различные модификации, замещения и вариации по отношению к раскрытому материалу без отступления от существа и/или важных характеристик настоящего изобретения. Соответственно, специалисту в данной области техники нетрудно понять из раскрытия, что последующие модификации, замещения и/или вариации, обеспечивающие практически такую же функцию или достижение практически такого же результата, как и в вариантах осуществления, раскрытых в данной заявке, можно применять в соответствии с подобными близкими вариантами осуществления настоящего изобретения. Таким образом, следующая формула изобретения предназначена для включения в свой объем модификаций, замещений и вариаций в отношении способов, производств, смесей химически связанных веществ, соединений, средств, способов и/или стадий, раскрытых в данной заявке. Формулу изобретения не следует рассматривать как ограниченную описанным порядком или элементами, если это не указано отдельно. Следует понимать, что можно осуществлять различные изменения формы и деталей без отступления от объема приложенной формулы изобретения.


СПОСОБ ЛЕЧЕНИЯ БОЛЕЗНЕЙ ГЛАЗ
Источник поступления информации: Роспатент

Всего документов: 382

Похожие РИД в системе



Похожие не найдены